(data stored in ACNUC7421 zone)

EMBL: CP001854.PE176

CP001854.PE176       Location/Qualifiers
FT   CDS             173667..174425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0176"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: avn:Avin_21180 2,3-dihydro-2,3-
FT                   dihydroxybenzoate dehydrogenase, short-chain
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48612"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F534"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48612.1"
FT                   /translation="MTGTAVVVGGGRGIGRAIAVELARDEGVERLVVADVDLELAQETA
FT                   AAGSGDAECVARRVDLAEPASVQELFAASREATRVAIPGGVFSASPSLELEREEMERIL
FT                   RINLVGCYHAAQLYAGAMASSGGGAIVGIASIAARMPRMRQAAYSASKAGLRQALRVLA
FT                   MEVAGDGVRINTVSPGPTDTPMMRELASDHSSVDDLAQGSALALRPRIPVGRVATSEDI
FT                   AVATRFLLSPGAAHIVMQDLVVDGGELLGM"
     MTGTAVVVGG GRGIGRAIAV ELARDEGVER LVVADVDLEL AQETAAAGSG DAECVARRVD        60
     LAEPASVQEL FAASREATRV AIPGGVFSAS PSLELEREEM ERILRINLVG CYHAAQLYAG       120
     AMASSGGGAI VGIASIAARM PRMRQAAYSA SKAGLRQALR VLAMEVAGDG VRINTVSPGP       180
     TDTPMMRELA SDHSSVDDLA QGSALALRPR IPVGRVATSE DIAVATRFLL SPGAAHIVMQ       240
     DLVVDGGELL GM                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page