(data stored in ACNUC7421 zone)

EMBL: CP001854.PE177

CP001854.PE177       Location/Qualifiers
FT   CDS             174428..175579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0177"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: mlo:mll4451
FT                   dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48613"
FT                   /db_xref="GOA:D3F535"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR020043"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3F535"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADB48613.1"
FT                   /translation="MDALLLHGGTVVDPEARGETRRRADVLVVDGRIAAVEEAPICPDG
FT                   VETVDVSGLLVTPGLVDLHAHVFVGQDLGVDPDVVGPASGTTTFVDTGSAGGHLFGAFR
FT                   RGTIDRATARVRAFLNISSIGATSILLAGELENLAYCDEEVAAICATEHADLVIGIKVR
FT                   ASGNVVGASGAEPMLRARRVADRLGLPLMIHLGPAPPGSDEIMAQLHAGDVLTHCFTGF
FT                   EDNRLFLDGRVRESVLAARERGVVFDVAHGMSAFDAEVATEMLAAGFLPDTISSDVHAY
FT                   SLDAIGDLPAVMSKFLALGMDVDDVIARTTLKPAQHAGLAADGVGTLRIGAPADVAAFE
FT                   LVEGPIAYADTRGGTFSGSRRLRAALTVRAGAIVHDARKERQP"
     MDALLLHGGT VVDPEARGET RRRADVLVVD GRIAAVEEAP ICPDGVETVD VSGLLVTPGL        60
     VDLHAHVFVG QDLGVDPDVV GPASGTTTFV DTGSAGGHLF GAFRRGTIDR ATARVRAFLN       120
     ISSIGATSIL LAGELENLAY CDEEVAAICA TEHADLVIGI KVRASGNVVG ASGAEPMLRA       180
     RRVADRLGLP LMIHLGPAPP GSDEIMAQLH AGDVLTHCFT GFEDNRLFLD GRVRESVLAA       240
     RERGVVFDVA HGMSAFDAEV ATEMLAAGFL PDTISSDVHA YSLDAIGDLP AVMSKFLALG       300
     MDVDDVIART TLKPAQHAGL AADGVGTLRI GAPADVAAFE LVEGPIAYAD TRGGTFSGSR       360
     RLRAALTVRA GAIVHDARKE RQP                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page