(data stored in ACNUC7421 zone)

EMBL: CP001854.PE178

CP001854.PE178       Location/Qualifiers
FT   CDS             175576..176421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0178"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   vvy:VV0550 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48614"
FT                   /db_xref="GOA:D3F536"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3F536"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ADB48614.1"
FT                   /translation="MKNGGTAEEAAFTTVKSADRVLVVLELLAGREPMRLMDIADELEM
FT                   PRSSTSNLLRTMARRRFVEYDEGDKRYRIGSRMRELARASEREGDLVSLAQPLMDRLVE
FT                   QTGETVQLAQLEAMEVVYLAISESPHPMKLVSEVGKRLFAHGTGVGKTLLAQLDLADAE
FT                   QRLRSVELPRFTPATIIDVDDLLDGLREIGERGYGTDDEEYVLGCRCIAMPVHGPRGDT
FT                   IAAMSVSIPTPRYDDEVGERALEALRSATAELSRQLGWVETASGAAVGAVGTSGAGEPA
FT                   "
     MKNGGTAEEA AFTTVKSADR VLVVLELLAG REPMRLMDIA DELEMPRSST SNLLRTMARR        60
     RFVEYDEGDK RYRIGSRMRE LARASEREGD LVSLAQPLMD RLVEQTGETV QLAQLEAMEV       120
     VYLAISESPH PMKLVSEVGK RLFAHGTGVG KTLLAQLDLA DAEQRLRSVE LPRFTPATII       180
     DVDDLLDGLR EIGERGYGTD DEEYVLGCRC IAMPVHGPRG DTIAAMSVSI PTPRYDDEVG       240
     ERALEALRSA TAELSRQLGW VETASGAAVG AVGTSGAGEP A                           281
//

If you have problems or comments...

PBIL Back to PBIL home page