(data stored in ACNUC7421 zone)

EMBL: CP001854.PE179

CP001854.PE179       Location/Qualifiers
FT   CDS             176418..177536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0179"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   sme:SM_b21134 putative amino acid processing enzyme, low
FT                   specificity D-threonine aldolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48615"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:D3F537"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ADB48615.1"
FT                   /translation="MTLDAVDTPALVVDRDVLRANVEAMAALARDAGVALRPHAKTHKL
FT                   PQVARMQLDAGAAGLTVAKLGEAEVFADAGVTDLLIAYPLVGELKLARLVALARRLASE
FT                   PGGCIAVAVDAVETATGISDAVAAAGVEVGVRVEVDTGMHRLGLEPASAALVELARAVA
FT                   ALPGLRFEGVMTHEGQAYQAASEAELERAAADACEAMVASAAAIRAAGVDCPVVSMGST
FT                   ATARFAAGHPGVTEIRPGTYVFNDRSQVAHGSATAGDLAATVLATVVSRPSAGVACVDA
FT                   GAKALTSDRMIVPGADGDFGAVAPSGWPVARASEEHGLVALPAGADVAVGTRVAIAPNH
FT                   ICPVVNLFDAVTVVERGHVVDRWPVAARGRMT"
     MTLDAVDTPA LVVDRDVLRA NVEAMAALAR DAGVALRPHA KTHKLPQVAR MQLDAGAAGL        60
     TVAKLGEAEV FADAGVTDLL IAYPLVGELK LARLVALARR LASEPGGCIA VAVDAVETAT       120
     GISDAVAAAG VEVGVRVEVD TGMHRLGLEP ASAALVELAR AVAALPGLRF EGVMTHEGQA       180
     YQAASEAELE RAAADACEAM VASAAAIRAA GVDCPVVSMG STATARFAAG HPGVTEIRPG       240
     TYVFNDRSQV AHGSATAGDL AATVLATVVS RPSAGVACVD AGAKALTSDR MIVPGADGDF       300
     GAVAPSGWPV ARASEEHGLV ALPAGADVAV GTRVAIAPNH ICPVVNLFDA VTVVERGHVV       360
     DRWPVAARGR MT                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page