(data stored in ACNUC7421 zone)

EMBL: CP001854.PE18

CP001854.PE18        Location/Qualifiers
FT   CDS             complement(22511..24019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0018"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: scl:sce0022 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48454"
FT                   /db_xref="GOA:D3EYQ1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADB48454.1"
FT                   /translation="MSTLLGTLLNDRYRLEARIGTGGMSTVYRALDTTLERPVAIKLMN
FT                   REIASDSDQLERFRREARAVAQLSHPHIVGVIDAGEDAGRPYIVFEYVEGETLKERIRR
FT                   LGQLPIGEAVAYAIEIARALGAAHARHIVHRDVKPQNVLIDEEGSAKVTDFGIARTLDE
FT                   DGLTQDGRVLGTTDYVSPEQALGHPVGGQSDLYSLGIVLWEMLTGSVPFRGENQVAVAM
FT                   KHVREEIPDVRELRPEVSASLASVIDRATAKDLLERYRSDEELIADLEDVLALETARAG
FT                   SATGEATTVIRTLPRSAQRRLPLSVRRPAWLAVLALLVVAALVAAIVFALENGERGTGR
FT                   SAGRARDGPVQLQQISLAQTAASDYDPTSSGGDGEEHSEETTFAVDNNPSTFWSTERYE
FT                   NAVLPKDGVGLAVDVSPGAVLRKMRVRTNTPGFSADVYVTDAADVPESLDDPAWRRVAT
FT                   SSDVQRRQDIDLDTAGQRSRHVLLWITRLPSGGKVEISEIALFR"
     MSTLLGTLLN DRYRLEARIG TGGMSTVYRA LDTTLERPVA IKLMNREIAS DSDQLERFRR        60
     EARAVAQLSH PHIVGVIDAG EDAGRPYIVF EYVEGETLKE RIRRLGQLPI GEAVAYAIEI       120
     ARALGAAHAR HIVHRDVKPQ NVLIDEEGSA KVTDFGIART LDEDGLTQDG RVLGTTDYVS       180
     PEQALGHPVG GQSDLYSLGI VLWEMLTGSV PFRGENQVAV AMKHVREEIP DVRELRPEVS       240
     ASLASVIDRA TAKDLLERYR SDEELIADLE DVLALETARA GSATGEATTV IRTLPRSAQR       300
     RLPLSVRRPA WLAVLALLVV AALVAAIVFA LENGERGTGR SAGRARDGPV QLQQISLAQT       360
     AASDYDPTSS GGDGEEHSEE TTFAVDNNPS TFWSTERYEN AVLPKDGVGL AVDVSPGAVL       420
     RKMRVRTNTP GFSADVYVTD AADVPESLDD PAWRRVATSS DVQRRQDIDL DTAGQRSRHV       480
     LLWITRLPSG GKVEISEIAL FR                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page