(data stored in ACNUC7421 zone)

EMBL: CP001854.PE180

CP001854.PE180       Location/Qualifiers
FT   CDS             177562..178743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0180"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rlg:Rleg_5221 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48616"
FT                   /db_xref="GOA:D3F538"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D3F538"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB48616.1"
FT                   /translation="MAAIRLTDVCKEYDGSGALAVDGVDLEIADGEFMVLVGPSGCGKS
FT                   TLLRMIAGLEDVTFGTIEIGERDVTDEEPRDRDVAMVFQNYALYPHLSVRENIGFGLKL
FT                   RKMAKAEMNERVERVARSLGLTEYLDRKPAQLSGGQRQRVAMGRAMVRQPAAYLMDEPL
FT                   SNLDAKLRVAMRAELARLHEQLGVTTVYVTHDQVEAMTLGSRVAVLRGGVLQQCDTPET
FT                   LFERPANAFVAGFIGSPAMNLLEGTVAGDVVRFGAESLALAPEVGERVGERDVILGIRP
FT                   TDFLLAGPDVDPALPRLRVVPDVVERLGSEIHIIFGIEATQLDLDGRGGLTGERDAQLL
FT                   GDTRALLTARLEAGAPVAVGQPVELAVRRERIHFFTRDDGLRIETADPALTTA"
     MAAIRLTDVC KEYDGSGALA VDGVDLEIAD GEFMVLVGPS GCGKSTLLRM IAGLEDVTFG        60
     TIEIGERDVT DEEPRDRDVA MVFQNYALYP HLSVRENIGF GLKLRKMAKA EMNERVERVA       120
     RSLGLTEYLD RKPAQLSGGQ RQRVAMGRAM VRQPAAYLMD EPLSNLDAKL RVAMRAELAR       180
     LHEQLGVTTV YVTHDQVEAM TLGSRVAVLR GGVLQQCDTP ETLFERPANA FVAGFIGSPA       240
     MNLLEGTVAG DVVRFGAESL ALAPEVGERV GERDVILGIR PTDFLLAGPD VDPALPRLRV       300
     VPDVVERLGS EIHIIFGIEA TQLDLDGRGG LTGERDAQLL GDTRALLTAR LEAGAPVAVG       360
     QPVELAVRRE RIHFFTRDDG LRIETADPAL TTA                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page