(data stored in ACNUC7421 zone)

EMBL: CP001854.PE181

CP001854.PE181       Location/Qualifiers
FT   CDS             complement(178809..179231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0181"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48617"
FT                   /db_xref="GOA:D3F539"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3F539"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADB48617.1"
FT                   /translation="MSVLLLDASVWIASVDGDDRHHAAARELIADGPGARELAALDLTV
FT                   FEVANVAVRSWRDVARATRLAELVEVSCASDLERIDGETAAYTVRIADELGLTAYDAAY
FT                   VAVSRRRGWTLVSCDMKDLVGPGHAVAPDDVPPLAS"
     MSVLLLDASV WIASVDGDDR HHAAARELIA DGPGARELAA LDLTVFEVAN VAVRSWRDVA        60
     RATRLAELVE VSCASDLERI DGETAAYTVR IADELGLTAY DAAYVAVSRR RGWTLVSCDM       120
     KDLVGPGHAV APDDVPPLAS                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page