(data stored in ACNUC7421 zone)

EMBL: CP001854.PE182

CP001854.PE182       Location/Qualifiers
FT   CDS             complement(179228..179461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0182"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48618"
FT                   /db_xref="GOA:D3F540"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D3F540"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ADB48618.1"
FT                   /translation="MAKVMISLPDDLLERFDTYAQRRRTTRSGLLRELAEHELAANSDA
FT                   RRRRVDELLANPGNYGGHGTRYVREDRNRDNP"
     MAKVMISLPD DLLERFDTYA QRRRTTRSGL LRELAEHELA ANSDARRRRV DELLANPGNY        60
     GGHGTRYVRE DRNRDNP                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page