(data stored in ACNUC7421 zone)

EMBL: CP001854.PE183

CP001854.PE183       Location/Qualifiers
FT   CDS             complement(179501..180925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0183"
FT                   /product="sugar transporter"
FT                   /note="TIGRFAM: sugar transporter; PFAM: General substrate
FT                   transporter; major facilitator superfamily MFS_1; KEGG:
FT                   cbd:CBUD_1731 D-xylose-proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48619"
FT                   /db_xref="GOA:D3F541"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3F541"
FT                   /inference="protein motif:TFAM:TIGR00879"
FT                   /protein_id="ADB48619.1"
FT                   /translation="MAEAAASGSGHESHYRRNVWVTAGVAAMGGALFGYDTGMISGAQV
FT                   FIEQDFDVSSSGIGLVVSAVTAGALLGALATGPLTQRMSRRAIILLAAVVFIFGAALAA
FT                   AAPNVEVLIGARLVIGLAVGFASTVVPLYISEVVPTARRGSMVAMFQLAITAGILLAYL
FT                   VNAVFAGSEEWRAVFALAAVPATALFIGMLLLPNSPRWLVAVGRVDDAREVMQHVRDPD
FT                   DPATEQELQEIVAAVDEDARRAKQPLAQALTSPLARTILTVGIGLGIFQQITGINTIIY
FT                   YAPTILKEAGLGTETAALTTVGIGALNFLATLFALTVVDRIGRRTILIVGMTGMVLTMA
FT                   ALSIVFAIDDFDGIGQIVAVASLFGFIACFAISWGWGFWVMASEIYPLFIRGQAISIGN
FT                   TIQWGANFVISLLFPILLASWGGAPVFAMLAAFGIAALLFTWRLVPETNGKTLEEIEAE
FT                   WRRRAGVRDEPAAAPA"
     MAEAAASGSG HESHYRRNVW VTAGVAAMGG ALFGYDTGMI SGAQVFIEQD FDVSSSGIGL        60
     VVSAVTAGAL LGALATGPLT QRMSRRAIIL LAAVVFIFGA ALAAAAPNVE VLIGARLVIG       120
     LAVGFASTVV PLYISEVVPT ARRGSMVAMF QLAITAGILL AYLVNAVFAG SEEWRAVFAL       180
     AAVPATALFI GMLLLPNSPR WLVAVGRVDD AREVMQHVRD PDDPATEQEL QEIVAAVDED       240
     ARRAKQPLAQ ALTSPLARTI LTVGIGLGIF QQITGINTII YYAPTILKEA GLGTETAALT       300
     TVGIGALNFL ATLFALTVVD RIGRRTILIV GMTGMVLTMA ALSIVFAIDD FDGIGQIVAV       360
     ASLFGFIACF AISWGWGFWV MASEIYPLFI RGQAISIGNT IQWGANFVIS LLFPILLASW       420
     GGAPVFAMLA AFGIAALLFT WRLVPETNGK TLEEIEAEWR RRAGVRDEPA AAPA             474
//

If you have problems or comments...

PBIL Back to PBIL home page