(data stored in ACNUC7421 zone)

EMBL: CP001854.PE184

CP001854.PE184       Location/Qualifiers
FT   CDS             181066..182772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0184"
FT                   /product="X-Pro dipeptidyl-peptidase domain protein"
FT                   /note="PFAM: X-Pro dipeptidyl-peptidase domain protein;
FT                   peptidase S15; KEGG: pat:Patl_0930 X-Pro
FT                   dipeptidyl-peptidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48620"
FT                   /db_xref="GOA:D3F542"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F542"
FT                   /inference="protein motif:PFAM:PF08530"
FT                   /protein_id="ADB48620.1"
FT                   /translation="MTLLSEIAGRSLRLPRAQTRDVVVERDLPATMDDGVVLLADRYIA
FT                   RAEPSDGTDSPPPTVLIRTPYGRRGFFGFVYGRLLAERGFQTVVQSVRGTFGSGGEFTP
FT                   FDERADGLATLRWLRDQPWCEGPVGMIGSSYMGLTQWAVASAADGSIGALAPSITASQF
FT                   HGQAYGGGSISLDTALSWMLIIAAQERRLAPLRLILGMRRSLPRAFDALPLQEVDALVA
FT                   GEPVPFFREWFDVTAPDDPYWTQRDFSADVAGVTAPVQLIGGWQDIFLPWLIEDYVALR
FT                   RAGRTTQLVVGPWAHTSPGLLAASTREGIAWLRAHLAGDRRLLDEAPVRVWVGGENAWR
FT                   ALPDWPPPGVRPWRLHLRGGGRLAEAPPPDPTAVAVQPGGAADAAASDTAPDRFRYDPN
FT                   DPTPALGGPVLLAREPVTDNRPLEARADVLTFTTAPLEHDVEALGPVEADLHVRTSSPY
FT                   ADVFVRVCDVEPDGRSLNVCDALIRLTADAPPAAADGSRRVSFQLWPTAHRFGAGHRVR
FT                   VLVAGGAHPRYARNAGTGEPPQTATRLVAVDHELLHDAAHPSAVVLSVRGG"
     MTLLSEIAGR SLRLPRAQTR DVVVERDLPA TMDDGVVLLA DRYIARAEPS DGTDSPPPTV        60
     LIRTPYGRRG FFGFVYGRLL AERGFQTVVQ SVRGTFGSGG EFTPFDERAD GLATLRWLRD       120
     QPWCEGPVGM IGSSYMGLTQ WAVASAADGS IGALAPSITA SQFHGQAYGG GSISLDTALS       180
     WMLIIAAQER RLAPLRLILG MRRSLPRAFD ALPLQEVDAL VAGEPVPFFR EWFDVTAPDD       240
     PYWTQRDFSA DVAGVTAPVQ LIGGWQDIFL PWLIEDYVAL RRAGRTTQLV VGPWAHTSPG       300
     LLAASTREGI AWLRAHLAGD RRLLDEAPVR VWVGGENAWR ALPDWPPPGV RPWRLHLRGG       360
     GRLAEAPPPD PTAVAVQPGG AADAAASDTA PDRFRYDPND PTPALGGPVL LAREPVTDNR       420
     PLEARADVLT FTTAPLEHDV EALGPVEADL HVRTSSPYAD VFVRVCDVEP DGRSLNVCDA       480
     LIRLTADAPP AAADGSRRVS FQLWPTAHRF GAGHRVRVLV AGGAHPRYAR NAGTGEPPQT       540
     ATRLVAVDHE LLHDAAHPSA VVLSVRGG                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page