(data stored in ACNUC7421 zone)

EMBL: CP001854.PE185

CP001854.PE185       Location/Qualifiers
FT   CDS             complement(182806..184461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0185"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: TAP domain protein; alpha/beta hydrolase fold;
FT                   KEGG: sde:Sde_0644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48621"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F543"
FT                   /inference="protein motif:PFAM:PF08386"
FT                   /protein_id="ADB48621.1"
FT                   /translation="MASRHSVARWLTACAATIALLAVLVPGAQAQNGDAGRPPALAWGD
FT                   CSAIEGANPRAECATATVPKDYGHRSRGTLDLYVARLPAKRPESRIGSLFVNFGGPGGT
FT                   AADRIATEPDTTEEGATFAALNERFDIVGVDPRGVGLSRPSIDCRANQETQGVYAQPFE
FT                   RPEILDPRAMVGRDVDYIAQCVRLNRDVLPYVSTANFARDLDGLRAAVGDDKMTYLGFS
FT                   YGTFLGATYESMFPRNTRAIVLDGALDPDQYVNDPLASLDEQSAGFERAVGRFLQACAR
FT                   DQAACAGFGGDDPWDALERLIEQAYASPIPAGDRPAIDGDDVNAAVVQAVYAKQLWPFL
FT                   ARALAALERGDGSRLRQLVDIFYGDNGDGTYDPITDRYFTIGALEQRYPHDLRTFLREG
FT                   RRSYQRYDHAWWNHGYVEAAWGFYPVEPRGVFRGPFVNPAGAPPTLVVGTTYDPATPYK
FT                   EARRLVGQLGNARLLTMRGDGHTAYGGNSPCIDAAVDAYLIDGTLPAEGTSCRQEVPFA
FT                   QPQPAAPAPLSAVADRQQDGPAIAVAPHVKPDFR"
     MASRHSVARW LTACAATIAL LAVLVPGAQA QNGDAGRPPA LAWGDCSAIE GANPRAECAT        60
     ATVPKDYGHR SRGTLDLYVA RLPAKRPESR IGSLFVNFGG PGGTAADRIA TEPDTTEEGA       120
     TFAALNERFD IVGVDPRGVG LSRPSIDCRA NQETQGVYAQ PFERPEILDP RAMVGRDVDY       180
     IAQCVRLNRD VLPYVSTANF ARDLDGLRAA VGDDKMTYLG FSYGTFLGAT YESMFPRNTR       240
     AIVLDGALDP DQYVNDPLAS LDEQSAGFER AVGRFLQACA RDQAACAGFG GDDPWDALER       300
     LIEQAYASPI PAGDRPAIDG DDVNAAVVQA VYAKQLWPFL ARALAALERG DGSRLRQLVD       360
     IFYGDNGDGT YDPITDRYFT IGALEQRYPH DLRTFLREGR RSYQRYDHAW WNHGYVEAAW       420
     GFYPVEPRGV FRGPFVNPAG APPTLVVGTT YDPATPYKEA RRLVGQLGNA RLLTMRGDGH       480
     TAYGGNSPCI DAAVDAYLID GTLPAEGTSC RQEVPFAQPQ PAAPAPLSAV ADRQQDGPAI       540
     AVAPHVKPDF R                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page