(data stored in ACNUC7421 zone)

EMBL: CP001854.PE186

CP001854.PE186       Location/Qualifiers
FT   CDS             184675..186897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0186"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: lch:Lcho_3018 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain
FT                   protein; PAS fold-3 domain protein; GGDEF domain containing
FT                   protein; PAS fold domain protein; PAS fold-4 domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48622"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3F544"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB48622.1"
FT                   /translation="MSSRPSFSAPFGERPREGKRDGRLVSRGLVVDAAPQQRARQALRA
FT                   AERLSRAVVDGLEEGVLVLDANLHPVSWNASVLRILGVTPEQLADVEQLAQAPATMSLR
FT                   YDSGKPVTPRDNPALRSLRHGAPVRATLHRETETGRERWITILARPIGGAHGTSRRGVV
FT                   CTFADVTSSVEAARRLREERDRAQHYLEVASTLVVVLDAGGRVELVNRQGCELLGYAEH
FT                   ELVGRDWNETVVPPGDRRDARAVFAQLLAGEQLPAERGETFLLTKAGEERKIAWRNAVV
FT                   RDATGTVASVLCSGEDVTERRRAEAQLAYLAHHDRLTGLPNRAPLEEQLQRDLARARRT
FT                   GGSVALVQVGLDNFKLVNDSLGHAAGDAVLSETAQRVAQLTRAGDVIARQGGDEFMLLL
FT                   DCGAEEAQVVAQLAGDRVMAALEQPFAVAGAEFHIGASIGIALFPGNANNAESLFKHAD
FT                   MAMHQAKRSGGGAVVFYERGAAEARERLSLTSRLRRAIDGDELRLHFQPIYRVEDGVLV
FT                   AVEALVRWEDPEHGLVPPAGFIPVAEETGLIEGIGSWVVEALCRQASRWAREGFRPRLC
FT                   FNLSPRQLRQPDLVDSIARTIARHELPPGQFCAELTETAVLSDERRHSSLLDELHEAGL
FT                   AIAIDDFGSGHSSLARLRDLPVQVLKVDRSFLRRVPEDPGSTAIVAAVLELGTALGMTT
FT                   VVEGVEDDAQLALLRRHGAPLAQGFLLGRPVPADQLDRSPAPAARA"
     MSSRPSFSAP FGERPREGKR DGRLVSRGLV VDAAPQQRAR QALRAAERLS RAVVDGLEEG        60
     VLVLDANLHP VSWNASVLRI LGVTPEQLAD VEQLAQAPAT MSLRYDSGKP VTPRDNPALR       120
     SLRHGAPVRA TLHRETETGR ERWITILARP IGGAHGTSRR GVVCTFADVT SSVEAARRLR       180
     EERDRAQHYL EVASTLVVVL DAGGRVELVN RQGCELLGYA EHELVGRDWN ETVVPPGDRR       240
     DARAVFAQLL AGEQLPAERG ETFLLTKAGE ERKIAWRNAV VRDATGTVAS VLCSGEDVTE       300
     RRRAEAQLAY LAHHDRLTGL PNRAPLEEQL QRDLARARRT GGSVALVQVG LDNFKLVNDS       360
     LGHAAGDAVL SETAQRVAQL TRAGDVIARQ GGDEFMLLLD CGAEEAQVVA QLAGDRVMAA       420
     LEQPFAVAGA EFHIGASIGI ALFPGNANNA ESLFKHADMA MHQAKRSGGG AVVFYERGAA       480
     EARERLSLTS RLRRAIDGDE LRLHFQPIYR VEDGVLVAVE ALVRWEDPEH GLVPPAGFIP       540
     VAEETGLIEG IGSWVVEALC RQASRWAREG FRPRLCFNLS PRQLRQPDLV DSIARTIARH       600
     ELPPGQFCAE LTETAVLSDE RRHSSLLDEL HEAGLAIAID DFGSGHSSLA RLRDLPVQVL       660
     KVDRSFLRRV PEDPGSTAIV AAVLELGTAL GMTTVVEGVE DDAQLALLRR HGAPLAQGFL       720
     LGRPVPADQL DRSPAPAARA                                                   740
//

If you have problems or comments...

PBIL Back to PBIL home page