(data stored in ACNUC7421 zone)

EMBL: CP001854.PE187

CP001854.PE187       Location/Qualifiers
FT   CDS             186894..188252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0187"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: ammonium
FT                   transporter; KEGG: ade:Adeh_2218 ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48623"
FT                   /db_xref="GOA:D3F545"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D3F545"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ADB48623.1"
FT                   /translation="MTESLVLAARSLGEVTIDLDALWLVVAAVLVMFMQAGFACVEIGF
FT                   SRGRNAGAVVAKVLFNFSLVTLVWWACGFALAFGGGAWLLGDSGFFLHVGETISAGSPI
FT                   AGTVTSADTGYVFFQLAFCAVSFAIVWGTTLERIRFVAYPIYGVVFAALIYPLVAHSIF
FT                   GGGLLGDVGDGMQDFAGSTVVHLTGATGGLAALLLLGPRRGKYGPDGSPRAIPGHSMPM
FT                   FGVGVLILWLGWFGFNAGSTLTTAGARFAEVALVTNLAAAAGVIGATLTVWLLTRRLDV
FT                   GMIGNGAIGALVAITAPSGYIELWAAPLIGAVAGALVVVSVLAIDRKLDDPVGALSAHG
FT                   VAGVWGTLSCGLFAAPRLVDAPGVPGEAGLVYSGSFEQLGVQALGVLVAFLLVFTLSYL
FT                   TFAAIKALFGLRVTDEEEQEGLDIVEHGMYGYPEQFIVAGDGFGEGFDSLPER"
     MTESLVLAAR SLGEVTIDLD ALWLVVAAVL VMFMQAGFAC VEIGFSRGRN AGAVVAKVLF        60
     NFSLVTLVWW ACGFALAFGG GAWLLGDSGF FLHVGETISA GSPIAGTVTS ADTGYVFFQL       120
     AFCAVSFAIV WGTTLERIRF VAYPIYGVVF AALIYPLVAH SIFGGGLLGD VGDGMQDFAG       180
     STVVHLTGAT GGLAALLLLG PRRGKYGPDG SPRAIPGHSM PMFGVGVLIL WLGWFGFNAG       240
     STLTTAGARF AEVALVTNLA AAAGVIGATL TVWLLTRRLD VGMIGNGAIG ALVAITAPSG       300
     YIELWAAPLI GAVAGALVVV SVLAIDRKLD DPVGALSAHG VAGVWGTLSC GLFAAPRLVD       360
     APGVPGEAGL VYSGSFEQLG VQALGVLVAF LLVFTLSYLT FAAIKALFGL RVTDEEEQEG       420
     LDIVEHGMYG YPEQFIVAGD GFGEGFDSLP ER                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page