(data stored in ACNUC7421 zone)

EMBL: CP001854.PE188

CP001854.PE188       Location/Qualifiers
FT   CDS             188347..189177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0188"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: scl:sce0253
FT                   branched-chain-amino-acid transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48624"
FT                   /db_xref="GOA:D3F546"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D3F546"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADB48624.1"
FT                   /translation="MTVLRVRIDGQPRAVEDAVIPVTDEGLLRGDGVFEVLRLYAGRVF
FT                   ALDQHLERMERSADGLRLPFDAAAAREDVEVLEATADGADAIVRLVSTRGGRRIALLET
FT                   VPPMPATVRLATVTFSPSGPLDGCKTLSYAANALATRLAIEDGADQALFVRPDGDVLEG
FT                   PNFAVFLGFAADAPLVTPPLSAGILDSITRRRLIGLVPVVERPVHAAELRHVEEAFVAS
FT                   TLREVLPVRAIDGRAIGRVPGPRTSDAERAFSAHVAQQTATFAATTVGEGRAPA"
     MTVLRVRIDG QPRAVEDAVI PVTDEGLLRG DGVFEVLRLY AGRVFALDQH LERMERSADG        60
     LRLPFDAAAA REDVEVLEAT ADGADAIVRL VSTRGGRRIA LLETVPPMPA TVRLATVTFS       120
     PSGPLDGCKT LSYAANALAT RLAIEDGADQ ALFVRPDGDV LEGPNFAVFL GFAADAPLVT       180
     PPLSAGILDS ITRRRLIGLV PVVERPVHAA ELRHVEEAFV ASTLREVLPV RAIDGRAIGR       240
     VPGPRTSDAE RAFSAHVAQQ TATFAATTVG EGRAPA                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page