(data stored in ACNUC7421 zone)

EMBL: CP001854.PE189

CP001854.PE189       Location/Qualifiers
FT   CDS             189246..190355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0189"
FT                   /product="Asparaginase/glutaminase"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48625"
FT                   /db_xref="GOA:D3F547"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:D3F547"
FT                   /inference="protein motif:PFAM:PF00710"
FT                   /protein_id="ADB48625.1"
FT                   /translation="MPDKTLLMLTTGGTIAGNVARDDGDPEEHIDNEALATVIEPTAAR
FT                   LEETWGVRVRLESQRIDDVDSSDILPSHWIALVDAIQEKYDDYDGFIVTHGTNTMGYTC
FT                   AALSFALNNLNKPVVVTGSQVPFGWPGSDALMNLDNALRVATYPYDGGIRGVVCVFGSH
FT                   IITGTRAKKATEFDLDAFTSFSAAGLGRIGRIIYMNDEHLKRHHAYLARGGTQPALLAR
FT                   DLAVSNGFDTRILSFTEFPGMLPDLFQAALEGLVERDEPLIRGVVFRAFGAGDVSTHLH
FT                   PCFEYLKSKEVPVVVTTQAPNGNSNFRVNDPGKELATRELAIPAHDMSIEAITTKLAWL
FT                   LARGTSYAKMPAAMHEDLHGEISVFPDRR"
     MPDKTLLMLT TGGTIAGNVA RDDGDPEEHI DNEALATVIE PTAARLEETW GVRVRLESQR        60
     IDDVDSSDIL PSHWIALVDA IQEKYDDYDG FIVTHGTNTM GYTCAALSFA LNNLNKPVVV       120
     TGSQVPFGWP GSDALMNLDN ALRVATYPYD GGIRGVVCVF GSHIITGTRA KKATEFDLDA       180
     FTSFSAAGLG RIGRIIYMND EHLKRHHAYL ARGGTQPALL ARDLAVSNGF DTRILSFTEF       240
     PGMLPDLFQA ALEGLVERDE PLIRGVVFRA FGAGDVSTHL HPCFEYLKSK EVPVVVTTQA       300
     PNGNSNFRVN DPGKELATRE LAIPAHDMSI EAITTKLAWL LARGTSYAKM PAAMHEDLHG       360
     EISVFPDRR                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page