(data stored in ACNUC7421 zone)

EMBL: CP001854.PE19

CP001854.PE19        Location/Qualifiers
FT   CDS             complement(24158..24391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0019"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="TIGRFAM: carbon storage regulator; PFAM: carbon
FT                   storage regulator; KEGG: hch:HCH_05205 carbon storage
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48455"
FT                   /db_xref="GOA:D3EYQ2"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ2"
FT                   /inference="protein motif:TFAM:TIGR00202"
FT                   /protein_id="ADB48455.1"
FT                   /translation="MLIITRRPGEKIVLGDDITVTVMEVSGQTVRLGIDAPKELPIYRE
FT                   EIWAAVKRENQAAATAADMPKLPERPPSARSE"
     MLIITRRPGE KIVLGDDITV TVMEVSGQTV RLGIDAPKEL PIYREEIWAA VKRENQAAAT        60
     AADMPKLPER PPSARSE                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page