(data stored in ACNUC7421 zone)

EMBL: CP001854.PE190

CP001854.PE190       Location/Qualifiers
FT   CDS             190362..192557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0190"
FT                   /product="1-alkyl-2-acetylglycerophosphocholine esterase"
FT                   /EC_number="3.1.1.47"
FT                   /note="KEGG: fph:Fphi_1520 L-asparaginase; PFAM:
FT                   Asparaginase/glutaminase; SMART: TIR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48626"
FT                   /db_xref="GOA:D3F548"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:D3F548"
FT                   /inference="protein motif:PRIAM:3.1.1.47"
FT                   /protein_id="ADB48626.1"
FT                   /translation="MPEIFFSYAHLDNELSEDNTHQFTDAVDHFRRVYTEIRKNRARPL
FT                   AEDELFFDQHSIRDGDLITKSTTDAAKECLVMLAFFSPNYFGSEGCRAEWRAFNDEQKR
FT                   GSAERARKLLIPIEVRPVDDVQLADEEGREWFTALTTADGLRRNITSEILLAKDTGPLY
FT                   AAVEQLDKTMDDHVTRVRGSSRGTEQTLGNVLVVKTPIRRNSLNDPAIAEDLTDAPGMK
FT                   WDRLDPVCVVYAGGTVGMVHQQDSDELHADYEMAAGVDTIVRYLRPKIAPLPFNIHFFS
FT                   LLQTIDSSNVTAANWVDLATLLQEQMSNYQGFVILHGTNTLAYTASALSFLLSDSITQP
FT                   VILTGAEVPLSVSNTDAVHNVEHAIRTAAHQAYNGPVRIPEVCVYWNNQLFRGNRVTKK
FT                   YASDRTASFHTPNMPVPLGTLANDRLAIDYEHVRRTPPDAAVHRQPQPIHDIAKPRVEV
FT                   MFIHPDMDFSDLEARFPPEMIDGLILLSYGPGNAPEDRDFLSMLDRLLSAGTIVVNITQ
FT                   CPYGRVELKLFETAATLFDLGVVDGYDMTLEAAYTKLLWAIARHGNRKQPGVREEIRKK
FT                   FQRCVAGEMSASVYTVSFGPSQTFHPHDGYLVSDIPKFDGEVDRHDITEVFLRLESLKL
FT                   PRDVTTAKVRVLFGRPPDTDAPEWAGNVLAEFTKTITAAERAAGEISKNLEITHPFRKC
FT                   FRNEGFDVSLCVEGIDEVEFTSLSVVIYTTAAWGRGK"
     MPEIFFSYAH LDNELSEDNT HQFTDAVDHF RRVYTEIRKN RARPLAEDEL FFDQHSIRDG        60
     DLITKSTTDA AKECLVMLAF FSPNYFGSEG CRAEWRAFND EQKRGSAERA RKLLIPIEVR       120
     PVDDVQLADE EGREWFTALT TADGLRRNIT SEILLAKDTG PLYAAVEQLD KTMDDHVTRV       180
     RGSSRGTEQT LGNVLVVKTP IRRNSLNDPA IAEDLTDAPG MKWDRLDPVC VVYAGGTVGM       240
     VHQQDSDELH ADYEMAAGVD TIVRYLRPKI APLPFNIHFF SLLQTIDSSN VTAANWVDLA       300
     TLLQEQMSNY QGFVILHGTN TLAYTASALS FLLSDSITQP VILTGAEVPL SVSNTDAVHN       360
     VEHAIRTAAH QAYNGPVRIP EVCVYWNNQL FRGNRVTKKY ASDRTASFHT PNMPVPLGTL       420
     ANDRLAIDYE HVRRTPPDAA VHRQPQPIHD IAKPRVEVMF IHPDMDFSDL EARFPPEMID       480
     GLILLSYGPG NAPEDRDFLS MLDRLLSAGT IVVNITQCPY GRVELKLFET AATLFDLGVV       540
     DGYDMTLEAA YTKLLWAIAR HGNRKQPGVR EEIRKKFQRC VAGEMSASVY TVSFGPSQTF       600
     HPHDGYLVSD IPKFDGEVDR HDITEVFLRL ESLKLPRDVT TAKVRVLFGR PPDTDAPEWA       660
     GNVLAEFTKT ITAAERAAGE ISKNLEITHP FRKCFRNEGF DVSLCVEGID EVEFTSLSVV       720
     IYTTAAWGRG K                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page