(data stored in ACNUC7421 zone)

EMBL: CP001854.PE191

CP001854.PE191       Location/Qualifiers
FT   CDS             192539..193906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0191"
FT                   /product="Aspartate racemase-like protein"
FT                   /note="KEGG: dda:Dd703_1302 aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48627"
FT                   /db_xref="GOA:D3F549"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D3F549"
FT                   /inference="protein motif:COG:COG1794"
FT                   /protein_id="ADB48627.1"
FT                   /translation="MGPGQVSAVVPEEVARNVAFLSDSGVWHVVSRNRPAFSCADAARK
FT                   RKRLSHRGQEVGIPLCDELKTAVCVVEHEHGQEFVVLHCRGHQLLDDDKLAAVLGAAVR
FT                   RMEPDELEQSFDLAYGLVTPFAFAERDDVRQVFDRTVIEPFFPPYTMMTNLGHHEYGVE
FT                   FQPRELVGALPRSSVEDIARGEGQRVPVEHTLGILTGNGPESGRFLWSRIDECIRNHPD
FT                   VPFRGDIGLPRVVVESVPEMGLSMELEERLSTVRPAVLDGVRRLCERGATVVGIACNTT
FT                   QYFVDDIREVCEAHGAQFVSIVEATAAALADEGIERVVFLGIGAVSDFDRWSDFRRIAG
FT                   EFAFDRPPDDLIDEIDDLAFLVKQRGIVSVTINPMRDIVRRAAASEDTVILVALTELSL
FT                   LVASQRRSRRRFVDTLQILAEAMAGIYIQERIPLDVGPEAAQEESAAARVPDAGSG"
     MGPGQVSAVV PEEVARNVAF LSDSGVWHVV SRNRPAFSCA DAARKRKRLS HRGQEVGIPL        60
     CDELKTAVCV VEHEHGQEFV VLHCRGHQLL DDDKLAAVLG AAVRRMEPDE LEQSFDLAYG       120
     LVTPFAFAER DDVRQVFDRT VIEPFFPPYT MMTNLGHHEY GVEFQPRELV GALPRSSVED       180
     IARGEGQRVP VEHTLGILTG NGPESGRFLW SRIDECIRNH PDVPFRGDIG LPRVVVESVP       240
     EMGLSMELEE RLSTVRPAVL DGVRRLCERG ATVVGIACNT TQYFVDDIRE VCEAHGAQFV       300
     SIVEATAAAL ADEGIERVVF LGIGAVSDFD RWSDFRRIAG EFAFDRPPDD LIDEIDDLAF       360
     LVKQRGIVSV TINPMRDIVR RAAASEDTVI LVALTELSLL VASQRRSRRR FVDTLQILAE       420
     AMAGIYIQER IPLDVGPEAA QEESAAARVP DAGSG                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page