(data stored in ACNUC7421 zone)

EMBL: CP001854.PE192

CP001854.PE192       Location/Qualifiers
FT   CDS             193959..194945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0192"
FT                   /product="Asparaginase/glutaminase"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: mms:mma_3667
FT                   L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48628"
FT                   /db_xref="GOA:D3F550"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:D3F550"
FT                   /inference="protein motif:PFAM:PF00710"
FT                   /protein_id="ADB48628.1"
FT                   /translation="MAIQAHAGRRVRILGAGGTIAMRGTSATPQLGVAALVAAIPGLHA
FT                   GDGLEAFDVVNKPSPHLTLADQLEVCRQARDAARRGMGVVVTHGTDSLEETAMLCDVIH
FT                   DAEAPIVFTGAIRPATAAGADGPANLLDAVSVAASEEAAGMGVLVVFGGEIHHARCARK
FT                   TDTTSLVAFSSPQTGPLGRVTEGHPTIWSHLPRNPPFDPPVLDKRVLVVPTGAGDDGTL
FT                   ARAALSTEPDGVVIGTLGAGHLAPPLLELWADAAERIPVVAYCRPERGVVLTGTYGYAG
FT                   SEQDLRDTGIIPAGFLSPQAARMKLLACVASGLSVDEVRWAFSQDDG"
     MAIQAHAGRR VRILGAGGTI AMRGTSATPQ LGVAALVAAI PGLHAGDGLE AFDVVNKPSP        60
     HLTLADQLEV CRQARDAARR GMGVVVTHGT DSLEETAMLC DVIHDAEAPI VFTGAIRPAT       120
     AAGADGPANL LDAVSVAASE EAAGMGVLVV FGGEIHHARC ARKTDTTSLV AFSSPQTGPL       180
     GRVTEGHPTI WSHLPRNPPF DPPVLDKRVL VVPTGAGDDG TLARAALSTE PDGVVIGTLG       240
     AGHLAPPLLE LWADAAERIP VVAYCRPERG VVLTGTYGYA GSEQDLRDTG IIPAGFLSPQ       300
     AARMKLLACV ASGLSVDEVR WAFSQDDG                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page