(data stored in ACNUC7421 zone)

EMBL: CP001854.PE193

CP001854.PE193       Location/Qualifiers
FT   CDS             complement(194949..195329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0193"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; Cupin
FT                   domain protein; KEGG: dvm:DvMF_2629 cupin 2 conserved
FT                   barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48629"
FT                   /db_xref="GOA:D3F551"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D3F551"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADB48629.1"
FT                   /translation="MHLARHAELEPYVTRDGSTIREWAGPGYSPARNQSLAEATLPPGR
FT                   ATTAHYHRAAEELYLFTAGRGRLRVGDAERDVQSGDCVVIPPGAVHKLWNTGDDDLVLV
FT                   CACSPAYSHEDTFLAEGEPDAG"
     MHLARHAELE PYVTRDGSTI REWAGPGYSP ARNQSLAEAT LPPGRATTAH YHRAAEELYL        60
     FTAGRGRLRV GDAERDVQSG DCVVIPPGAV HKLWNTGDDD LVLVCACSPA YSHEDTFLAE       120
     GEPDAG                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page