(data stored in ACNUC7421 zone)

EMBL: CP001854.PE194

CP001854.PE194       Location/Qualifiers
FT   CDS             195405..196082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0194"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_5545
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48630"
FT                   /db_xref="GOA:D3F552"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D3F552"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48630.1"
FT                   /translation="MNAMVQSTNGRSRLPRAQRELQILDIAHARFAERGYAAVTMDEVA
FT                   SAAGVTKPLLYAYFGNKERLYRACMERAGEAMLATVVEAIRAAEGPTEALRDGLRAFFA
FT                   FVDGDRDAWRVLFDETHPVGGELARSVADYRQRLVGLVAETQLALVPEHNRERAATEVE
FT                   ALSHALLGASEALARWWLRTGAMPPADAAELLVATVEPGLQARAALRFIPPTPEQTKEP
FT                   NDR"
     MNAMVQSTNG RSRLPRAQRE LQILDIAHAR FAERGYAAVT MDEVASAAGV TKPLLYAYFG        60
     NKERLYRACM ERAGEAMLAT VVEAIRAAEG PTEALRDGLR AFFAFVDGDR DAWRVLFDET       120
     HPVGGELARS VADYRQRLVG LVAETQLALV PEHNRERAAT EVEALSHALL GASEALARWW       180
     LRTGAMPPAD AAELLVATVE PGLQARAALR FIPPTPEQTK EPNDR                       225
//

If you have problems or comments...

PBIL Back to PBIL home page