(data stored in ACNUC7421 zone)

EMBL: CP001854.PE195

CP001854.PE195       Location/Qualifiers
FT   CDS             196072..197352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0195"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: pmy:Pmen_0745 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48631"
FT                   /db_xref="GOA:D3F553"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D3F553"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADB48631.1"
FT                   /translation="MTADGPRRVAVLGGNRIPFARSNSVYSKASNQDMLTAALDGLVSR
FT                   YGLEGERLGEVVAGAVLKHSRDFNLTRECVLGSRLAPETPAYDIQQACGTGLEAAILVA
FT                   NKIRLGQIESGVAGGTDTTSDAPLAVNEDLREILLDANRKKSTQDKLKTLLRLRPQHLA
FT                   PAIPRNEEPRTGLSMGEHQARTAAEWGITREAQDALAVRSHKNLAAAYERGFQDDLVTP
FT                   YLGLERDQNLRPDSNVEKAAKLKPVFGGKDGTMTAANSTPLSDGAAVALLGSEAWAQEH
FT                   ELTPLAYFVDGEAAAVDYVHGKEGLLMAPAYAVPRMLARNGLTLQEFDLYEIHEAFASQ
FT                   VLSTLKAWEDPAFCTQRLGLDRPLGAIDRDKLNVNGSSLAAGHPFAATGGRIVAGLAKA
FT                   LHERGGGRGLISVCAAGGQGVVAILEA"
     MTADGPRRVA VLGGNRIPFA RSNSVYSKAS NQDMLTAALD GLVSRYGLEG ERLGEVVAGA        60
     VLKHSRDFNL TRECVLGSRL APETPAYDIQ QACGTGLEAA ILVANKIRLG QIESGVAGGT       120
     DTTSDAPLAV NEDLREILLD ANRKKSTQDK LKTLLRLRPQ HLAPAIPRNE EPRTGLSMGE       180
     HQARTAAEWG ITREAQDALA VRSHKNLAAA YERGFQDDLV TPYLGLERDQ NLRPDSNVEK       240
     AAKLKPVFGG KDGTMTAANS TPLSDGAAVA LLGSEAWAQE HELTPLAYFV DGEAAAVDYV       300
     HGKEGLLMAP AYAVPRMLAR NGLTLQEFDL YEIHEAFASQ VLSTLKAWED PAFCTQRLGL       360
     DRPLGAIDRD KLNVNGSSLA AGHPFAATGG RIVAGLAKAL HERGGGRGLI SVCAAGGQGV       420
     VAILEA                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page