(data stored in ACNUC7421 zone)

EMBL: CP001854.PE196

CP001854.PE196       Location/Qualifiers
FT   CDS             197356..198768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0196"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rpf:Rpic12D_0431 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48632"
FT                   /db_xref="GOA:D3F554"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F554"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48632.1"
FT                   /translation="MSDRYTDLINTPLGRLVQKQVGLPAPVPLKRYSPGDPAVDGRVLL
FT                   AGAPGGRLASALAAIVADTGAEASTPLREDLRAAAAEAGLDAGPWTPAAAATQRYGALV
FT                   FDATGISEPAELKALHDFFGATIRRVQRCGRVVVLGTTPSAASTPSEAIAQRALEGFTR
FT                   SVGKELKAGATAQLVYVAPGAEDQLASTLRFLLSPKSAYVDGQVIRVGEAGAVPAIDWE
FT                   QPLAGKVALVTGASRGIGAAIAATLARDGAHVVGLDVPALQSDLEAVTSALGGSALTLD
FT                   ITADDAPRAIAAHLRREHGGVDVVVHNAGITRDKTLARMDDDKWSSVIAVNLAAVQRIT
FT                   DALIAGRSRAVLNDGGRIVCVSSIAGVAGNFGQTNYATSKAGVIGVVESYAPLLAKQGA
FT                   TINAVAPGFIETQMTAKIPFATREVGRRMNSLSQGGLPVDVAEAIAYFASPASTGVTGN
FT                   VVRVCGQSLLGA"
     MSDRYTDLIN TPLGRLVQKQ VGLPAPVPLK RYSPGDPAVD GRVLLAGAPG GRLASALAAI        60
     VADTGAEAST PLREDLRAAA AEAGLDAGPW TPAAAATQRY GALVFDATGI SEPAELKALH       120
     DFFGATIRRV QRCGRVVVLG TTPSAASTPS EAIAQRALEG FTRSVGKELK AGATAQLVYV       180
     APGAEDQLAS TLRFLLSPKS AYVDGQVIRV GEAGAVPAID WEQPLAGKVA LVTGASRGIG       240
     AAIAATLARD GAHVVGLDVP ALQSDLEAVT SALGGSALTL DITADDAPRA IAAHLRREHG       300
     GVDVVVHNAG ITRDKTLARM DDDKWSSVIA VNLAAVQRIT DALIAGRSRA VLNDGGRIVC       360
     VSSIAGVAGN FGQTNYATSK AGVIGVVESY APLLAKQGAT INAVAPGFIE TQMTAKIPFA       420
     TREVGRRMNS LSQGGLPVDV AEAIAYFASP ASTGVTGNVV RVCGQSLLGA                  470
//

If you have problems or comments...

PBIL Back to PBIL home page