(data stored in ACNUC7421 zone)

EMBL: CP001854.PE197

CP001854.PE197       Location/Qualifiers
FT   CDS             198770..199663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0197"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   abo:ABO_1719 MaoC like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48633"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3F555"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADB48633.1"
FT                   /translation="MASAPTSTTRELSAPPCTATLYAKAALPLIPGASALPFVAGGGKT
FT                   IPRTTLTLNGVTADPDQLVSYDRVCGFTLRDTLPSTYLHIRAFPLHMALMTDGSFPFGA
FT                   VGLVHLRNRITQLRPVGTTETFDLRVHTMPVQPHPKGRTFTIVSEARVGDELVWQDAST
FT                   MLTRGKGSGGQEPRPVDDGPAPKDLPFVAEWRLAEDLGRRYGAASGDRNPIHMHALSAK
FT                   LLGFPRAIAHGMWTKARCLAALESTLPDAYTVDVTFRRPILLPGKVAFAAEDGRFAVRN
FT                   VKDSSKIHLEGRVTAA"
     MASAPTSTTR ELSAPPCTAT LYAKAALPLI PGASALPFVA GGGKTIPRTT LTLNGVTADP        60
     DQLVSYDRVC GFTLRDTLPS TYLHIRAFPL HMALMTDGSF PFGAVGLVHL RNRITQLRPV       120
     GTTETFDLRV HTMPVQPHPK GRTFTIVSEA RVGDELVWQD ASTMLTRGKG SGGQEPRPVD       180
     DGPAPKDLPF VAEWRLAEDL GRRYGAASGD RNPIHMHALS AKLLGFPRAI AHGMWTKARC       240
     LAALESTLPD AYTVDVTFRR PILLPGKVAF AAEDGRFAVR NVKDSSKIHL EGRVTAA          297
//

If you have problems or comments...

PBIL Back to PBIL home page