(data stored in ACNUC7421 zone)

EMBL: CP001854.PE198

CP001854.PE198       Location/Qualifiers
FT   CDS             199681..200976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0198"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: abo:ABO_1701
FT                   acyl-CoA dehydrogenase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48634"
FT                   /db_xref="GOA:D3F556"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D3F556"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB48634.1"
FT                   /translation="MGLGLRALGRFAGSDLVDKLGIRKQSEAVVYRATRDGFRAVGAAN
FT                   RTFKQVSTNGKKPARLKPSGSGVFDLTPSDEQQMLGEAFGEFGAERLRPNALKADAAAQ
FT                   APPELLAEAAELGLTMLGVPEDLGGAVSERSSVTAVLAAEALSHGDMGLAAAALAPAGV
FT                   ATALSLWGDAEQQETYLPALIGEDVAVAALAIHEPRPLFDPFELETTARIDGADYVLSG
FT                   VKSFVPRATEAELLVVAARIAGHGPGLFLVETKSDGVLAKAAPGMGVRAAAVGEVLLEE
FT                   VRVPARALLGDGSPAVYADAVRRARLAWCALAIGTGKAVLDYVIPYVNERVAFGEPISH
FT                   RQSVAFAVSNIAIELEGMRLATLRAASRADMEKEFAREVALARHLCSEKGAWIGSEGVQ
FT                   LLGGHGYIKEHPVERWYRDLRAVGVVEGALLV"
     MGLGLRALGR FAGSDLVDKL GIRKQSEAVV YRATRDGFRA VGAANRTFKQ VSTNGKKPAR        60
     LKPSGSGVFD LTPSDEQQML GEAFGEFGAE RLRPNALKAD AAAQAPPELL AEAAELGLTM       120
     LGVPEDLGGA VSERSSVTAV LAAEALSHGD MGLAAAALAP AGVATALSLW GDAEQQETYL       180
     PALIGEDVAV AALAIHEPRP LFDPFELETT ARIDGADYVL SGVKSFVPRA TEAELLVVAA       240
     RIAGHGPGLF LVETKSDGVL AKAAPGMGVR AAAVGEVLLE EVRVPARALL GDGSPAVYAD       300
     AVRRARLAWC ALAIGTGKAV LDYVIPYVNE RVAFGEPISH RQSVAFAVSN IAIELEGMRL       360
     ATLRAASRAD MEKEFAREVA LARHLCSEKG AWIGSEGVQL LGGHGYIKEH PVERWYRDLR       420
     AVGVVEGALL V                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page