(data stored in ACNUC7421 zone)

EMBL: CP001854.PE199

CP001854.PE199       Location/Qualifiers
FT   CDS             200989..202209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0199"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: aci:ACIAD1412
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48635"
FT                   /db_xref="GOA:D3F557"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D3F557"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB48635.1"
FT                   /translation="MTMNLEVPKKFLPLVGQAHQVAEEIFRPVSRKYDQEEHAYPRELD
FT                   MLAALLDGMNDGSDMGGGAGAGGVRRQENSNGEIRNGSNMSTALGVAELCWGDVGLLLT
FT                   MPRQGLGNSAIASVANDEQLERFRGKWAAMAITEPEAGSDSAAIRTTAVLDRETGEYVL
FT                   NGEKIYVTSGERADLVVVWATLDRSLGRAAIKSFVVERSNPGMILDRLEHKLGIRASDT
FT                   AAFRLENCRVKPENLLGSPEVDVKRGFAGVMQTFDNTRPLVAAMAVGLTRACLEQTKEL
FT                   LAEAGVEVDYDKPAQSQPAAAAEYLSMEADYEAARLLTLEATWMADNSKPNSLQASYAK
FT                   AKAGRTCVDVAMRCVRLAGSRGYGEELLLEKWARDGKILDIFEGTQQIQLLIIARQLLG
FT                   KTSAELR"
     MTMNLEVPKK FLPLVGQAHQ VAEEIFRPVS RKYDQEEHAY PRELDMLAAL LDGMNDGSDM        60
     GGGAGAGGVR RQENSNGEIR NGSNMSTALG VAELCWGDVG LLLTMPRQGL GNSAIASVAN       120
     DEQLERFRGK WAAMAITEPE AGSDSAAIRT TAVLDRETGE YVLNGEKIYV TSGERADLVV       180
     VWATLDRSLG RAAIKSFVVE RSNPGMILDR LEHKLGIRAS DTAAFRLENC RVKPENLLGS       240
     PEVDVKRGFA GVMQTFDNTR PLVAAMAVGL TRACLEQTKE LLAEAGVEVD YDKPAQSQPA       300
     AAAEYLSMEA DYEAARLLTL EATWMADNSK PNSLQASYAK AKAGRTCVDV AMRCVRLAGS       360
     RGYGEELLLE KWARDGKILD IFEGTQQIQL LIIARQLLGK TSAELR                      406
//

If you have problems or comments...

PBIL Back to PBIL home page