(data stored in ACNUC7421 zone)

EMBL: CP001854.PE2

CP001854.PE2         Location/Qualifiers
FT   CDS             1570..2679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: aeh:Mlg_0002 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48438"
FT                   /db_xref="GOA:D3EYQ5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ5"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADB48438.1"
FT                   /translation="MKISAAREELLAQLQTVSRVASTRGAIQALSGVQLIAAGGRVELR
FT                   ATDMEVGLRVPLPAEIEREGSVVLPARLIVDVVRSLSGPTATLELRPAEQDVELVAGNA
FT                   QFHIRTLRAEDFPPFPEPESEGVVSVPAKAFVETVLRVANSASRDETRPVLTGIMVSAS
FT                   ERELRMVATDSYRLSVKETTLEEPLVGGFEANVPARALQELARLVQQIDGEQLSVGVRQ
FT                   NQVVFQIGEVVLSSRLIEGQFPNYRQLLPDSYEHELTITGSEVTDVVRRISLLAQKNAP
FT                   LRLSFAPGELTVSAQTPDIGEARESLPVAFQGEPFEIGFNPDFLRDGLESVGSGDVMLK
FT                   LISPLRPGLIQSAEDGGFLYLIMPIRLNV"
     MKISAAREEL LAQLQTVSRV ASTRGAIQAL SGVQLIAAGG RVELRATDME VGLRVPLPAE        60
     IEREGSVVLP ARLIVDVVRS LSGPTATLEL RPAEQDVELV AGNAQFHIRT LRAEDFPPFP       120
     EPESEGVVSV PAKAFVETVL RVANSASRDE TRPVLTGIMV SASERELRMV ATDSYRLSVK       180
     ETTLEEPLVG GFEANVPARA LQELARLVQQ IDGEQLSVGV RQNQVVFQIG EVVLSSRLIE       240
     GQFPNYRQLL PDSYEHELTI TGSEVTDVVR RISLLAQKNA PLRLSFAPGE LTVSAQTPDI       300
     GEARESLPVA FQGEPFEIGF NPDFLRDGLE SVGSGDVMLK LISPLRPGLI QSAEDGGFLY       360
     LIMPIRLNV                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page