(data stored in ACNUC7421 zone)

EMBL: CP001854.PE20

CP001854.PE20        Location/Qualifiers
FT   CDS             complement(24438..24899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0020"
FT                   /product="protein of unknown function DUF180"
FT                   /note="PFAM: protein of unknown function DUF180; KEGG:
FT                   gme:Gmet_0441 flagellar assembly protein FliW"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48456"
FT                   /db_xref="GOA:D3EYQ3"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ3"
FT                   /inference="protein motif:PFAM:PF02623"
FT                   /protein_id="ADB48456.1"
FT                   /translation="MPLTIDSTRFGQIEVEPDSVIEFPHGLIGFESRRFALVARETDAD
FT                   FLWLHSLEDPALAVPVTDPRRFFSGYSVELADEERERLGLAEPTATDIYVTVRASDQLE
FT                   GFTANLRAPIVISAGRGHQVINQAAEAPLRAPLFGELAEEAANAAGRAA"
     MPLTIDSTRF GQIEVEPDSV IEFPHGLIGF ESRRFALVAR ETDADFLWLH SLEDPALAVP        60
     VTDPRRFFSG YSVELADEER ERLGLAEPTA TDIYVTVRAS DQLEGFTANL RAPIVISAGR       120
     GHQVINQAAE APLRAPLFGE LAEEAANAAG RAA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page