(data stored in ACNUC7421 zone)

EMBL: CP001854.PE200

CP001854.PE200       Location/Qualifiers
FT   CDS             complement(202244..203032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0200"
FT                   /product="peptidase S51 dipeptidase E"
FT                   /note="PFAM: peptidase S51 dipeptidase E; KEGG:
FT                   pol:Bpro_2070 peptidase S51, dipeptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48636"
FT                   /db_xref="GOA:D3F558"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3F558"
FT                   /inference="protein motif:PFAM:PF03575"
FT                   /protein_id="ADB48636.1"
FT                   /translation="MTDPRRILAMGGGGFTMEPDNPALDDYALSLTAAREPRVLFLPTA
FT                   SGDPTAQITSFYGRFGRTASATHLSLFRRHGSARSLAEIVLEQDVIYVGGGSMRNLLAI
FT                   WSAHELDTLLIEAWTRGIVLVGLSAGAMCWFEGGITRSGGPPETLLGLGLLPGSFTVHA
FT                   DGEPERLPVWLAALRSGELPGGWAADDGVALLFHGTRMVRAVSSRPGTAALKADMVGGE
FT                   LVRHRIEPELLGSGPHSPLDAPVGDDIRELRDLRYGMRHR"
     MTDPRRILAM GGGGFTMEPD NPALDDYALS LTAAREPRVL FLPTASGDPT AQITSFYGRF        60
     GRTASATHLS LFRRHGSARS LAEIVLEQDV IYVGGGSMRN LLAIWSAHEL DTLLIEAWTR       120
     GIVLVGLSAG AMCWFEGGIT RSGGPPETLL GLGLLPGSFT VHADGEPERL PVWLAALRSG       180
     ELPGGWAADD GVALLFHGTR MVRAVSSRPG TAALKADMVG GELVRHRIEP ELLGSGPHSP       240
     LDAPVGDDIR ELRDLRYGMR HR                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page