(data stored in ACNUC7421 zone)

EMBL: CP001854.PE201

CP001854.PE201       Location/Qualifiers
FT   CDS             complement(203029..203778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0201"
FT                   /product="peptidase S51 dipeptidase E"
FT                   /note="PFAM: peptidase S51 dipeptidase E; KEGG: vpa:VPA1746
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48637"
FT                   /db_xref="GOA:D3F559"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3F559"
FT                   /inference="protein motif:PFAM:PF03575"
FT                   /protein_id="ADB48637.1"
FT                   /translation="MTTRPPQIVAFGGGGFSMEAGNPLLDDYVLSLTGVERPRVCFVPT
FT                   ASGDADHYVVRFYRTFSMQCETSHVSLFRRDRGSGAVEGDLEEHLLSQDVIYVGGGSVV
FT                   SLLGAWRAHGLDRILKAAWRKGVVLCGLSAGSLCWFAEAVTAFHGAPSVVRGLGLLPFS
FT                   NCVHYDGEPARREEYRRFVGDGVRPGYAADDGAALHFEHRQLKHVVSSRPRAQAYRVEP
FT                   VGSEIAESPLHARYLGERMPDMLMATA"
     MTTRPPQIVA FGGGGFSMEA GNPLLDDYVL SLTGVERPRV CFVPTASGDA DHYVVRFYRT        60
     FSMQCETSHV SLFRRDRGSG AVEGDLEEHL LSQDVIYVGG GSVVSLLGAW RAHGLDRILK       120
     AAWRKGVVLC GLSAGSLCWF AEAVTAFHGA PSVVRGLGLL PFSNCVHYDG EPARREEYRR       180
     FVGDGVRPGY AADDGAALHF EHRQLKHVVS SRPRAQAYRV EPVGSEIAES PLHARYLGER       240
     MPDMLMATA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page