(data stored in ACNUC7421 zone)

EMBL: CP001854.PE202

CP001854.PE202       Location/Qualifiers
FT   CDS             complement(203867..205255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0202"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mxa:MXAN_3943
FT                   cytochrome P450 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48638"
FT                   /db_xref="GOA:D3F560"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D3F560"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADB48638.1"
FT                   /translation="MAPAAPDTRSLPPGPTGPRVLTVSRFLLQPTRFVGECRERYGRLF
FT                   TIRLSPGRTVVVAADAAVAKEVFTGDPALLHAGEGNVVLRPLLGPRSVLLLDGPEHLRQ
FT                   RRLMLPPFHGERMRGYGERMRAIADRHVAQWPVGEPFAVQRSMQAITLEVILRVVFGVE
FT                   EPARVAQLSAPLRRLLDSTEQPWRLLALQLTRSEGARPRTPWGRVRRLLAPVDAMIYEE
FT                   IAARRAELESGRPTRDDILTLLLSARDEDDQPLTDAELRDELMTLLLAGHETTATALTW
FT                   TLERITRHPEVLARLEAEVGGEGADAYLDAVIKETLRLRPVVPAVVRKLQAPLTFGGWD
FT                   LPAGVNIAPNIWLIHRDPALYPEPEAFRPERFLDRTPGTYEWLPFGGGIRRCLGASFAL
FT                   YEMRMVLSTILERTRLAPTTDAPEQVTRRFVTFSPASGGRVTITQRLTPAAAGSAAPQP
FT                   RVPA"
     MAPAAPDTRS LPPGPTGPRV LTVSRFLLQP TRFVGECRER YGRLFTIRLS PGRTVVVAAD        60
     AAVAKEVFTG DPALLHAGEG NVVLRPLLGP RSVLLLDGPE HLRQRRLMLP PFHGERMRGY       120
     GERMRAIADR HVAQWPVGEP FAVQRSMQAI TLEVILRVVF GVEEPARVAQ LSAPLRRLLD       180
     STEQPWRLLA LQLTRSEGAR PRTPWGRVRR LLAPVDAMIY EEIAARRAEL ESGRPTRDDI       240
     LTLLLSARDE DDQPLTDAEL RDELMTLLLA GHETTATALT WTLERITRHP EVLARLEAEV       300
     GGEGADAYLD AVIKETLRLR PVVPAVVRKL QAPLTFGGWD LPAGVNIAPN IWLIHRDPAL       360
     YPEPEAFRPE RFLDRTPGTY EWLPFGGGIR RCLGASFALY EMRMVLSTIL ERTRLAPTTD       420
     APEQVTRRFV TFSPASGGRV TITQRLTPAA AGSAAPQPRV PA                          462
//

If you have problems or comments...

PBIL Back to PBIL home page