(data stored in ACNUC7421 zone)

EMBL: CP001854.PE203

CP001854.PE203       Location/Qualifiers
FT   CDS             complement(205265..205603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48639"
FT                   /db_xref="GOA:D3F561"
FT                   /db_xref="UniProtKB/TrEMBL:D3F561"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48639.1"
FT                   /translation="MQRLPSWPIAAGSLLLGFAVADVTGVRPLGGIVLFLGALWCGLRW
FT                   RREQGLAVAVALVAAFLAAFVLSHPLGKAIGSWPAVLVVSAFVGTIVWARVDRVAPPGT
FT                   GVSAAPSR"
     MQRLPSWPIA AGSLLLGFAV ADVTGVRPLG GIVLFLGALW CGLRWRREQG LAVAVALVAA        60
     FLAAFVLSHP LGKAIGSWPA VLVVSAFVGT IVWARVDRVA PPGTGVSAAP SR               112
//

If you have problems or comments...

PBIL Back to PBIL home page