(data stored in ACNUC7421 zone)

EMBL: CP001854.PE204

CP001854.PE204       Location/Qualifiers
FT   CDS             complement(205641..207971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0204"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48640"
FT                   /db_xref="GOA:D3F562"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D3F562"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ADB48640.1"
FT                   /translation="MKSNDRGGLHRLGRFCVRRHRLVLLVWVLGAVGLGVWAGQLGTQT
FT                   NDNVSLPGTDSQRAADVLDRDFSSGASNGTNPIVLRAPAGVRLTDAAERRAVTAIAAAY
FT                   ARDPGVRAVVSPLEPAGASQLSRDARIGYLGLSLRDSPSTLTLSEAERLLSVAQDAARP
FT                   AGLQVAAGGYLGADLSQAGSADSEAIGLLAAVVVLLFTFGTVVAMGLPLLTAILGLGTG
FT                   LSLITLASHVVQVPSTAPALATMIGLGVGIDYALFVVTRHREQMAAGVELRESIARAVA
FT                   TSGSAVVFAGGTVVIALCSLLLTGIPLVQQMGCLAAIAVLVAVLAAITLLPAALAAVGP
FT                   RIDSLALPWVRRARREAEAERARAASAGAPAAGSAAASAAPASDSATASATSAASAAPA
FT                   SAGAAAPAHPTMWLRWARLVADRPWPALVVALLVLGALAWPLTSLDLGQSDTGQLPRDT
FT                   TARQAYDMLAEGFGAGSNGPLLIAVRLPADAARASAEAVAGRLAAALRATPGVAAVGPP
FT                   LPAPRGDALLLTLTPTTAPSAPATEALVRHLRADTIPAALGDSGTAAFVGGSTAGYIDL
FT                   ADEIRDRLPLVIAVVLTLSFLLLTLAFRSLIVPLKAVLMNLLSIGAAFGVVSFVFSHDW
FT                   SAQLLGVEGAAPIVSFVPLMMFAILFGLSMDYEVFLMTHVRERWQATGDAHRAVIEGLA
FT                   GTARVITSAALIMVAVFLAFLLDGNPTIKQFGLGMAVAVAVDATVIRCLLVPAIMSLLG
FT                   RRAWWMPRRLERLTPRLSIEGDG"
     MKSNDRGGLH RLGRFCVRRH RLVLLVWVLG AVGLGVWAGQ LGTQTNDNVS LPGTDSQRAA        60
     DVLDRDFSSG ASNGTNPIVL RAPAGVRLTD AAERRAVTAI AAAYARDPGV RAVVSPLEPA       120
     GASQLSRDAR IGYLGLSLRD SPSTLTLSEA ERLLSVAQDA ARPAGLQVAA GGYLGADLSQ       180
     AGSADSEAIG LLAAVVVLLF TFGTVVAMGL PLLTAILGLG TGLSLITLAS HVVQVPSTAP       240
     ALATMIGLGV GIDYALFVVT RHREQMAAGV ELRESIARAV ATSGSAVVFA GGTVVIALCS       300
     LLLTGIPLVQ QMGCLAAIAV LVAVLAAITL LPAALAAVGP RIDSLALPWV RRARREAEAE       360
     RARAASAGAP AAGSAAASAA PASDSATASA TSAASAAPAS AGAAAPAHPT MWLRWARLVA       420
     DRPWPALVVA LLVLGALAWP LTSLDLGQSD TGQLPRDTTA RQAYDMLAEG FGAGSNGPLL       480
     IAVRLPADAA RASAEAVAGR LAAALRATPG VAAVGPPLPA PRGDALLLTL TPTTAPSAPA       540
     TEALVRHLRA DTIPAALGDS GTAAFVGGST AGYIDLADEI RDRLPLVIAV VLTLSFLLLT       600
     LAFRSLIVPL KAVLMNLLSI GAAFGVVSFV FSHDWSAQLL GVEGAAPIVS FVPLMMFAIL       660
     FGLSMDYEVF LMTHVRERWQ ATGDAHRAVI EGLAGTARVI TSAALIMVAV FLAFLLDGNP       720
     TIKQFGLGMA VAVAVDATVI RCLLVPAIMS LLGRRAWWMP RRLERLTPRL SIEGDG           776
//

If you have problems or comments...

PBIL Back to PBIL home page