(data stored in ACNUC7421 zone)

EMBL: CP001854.PE205

CP001854.PE205       Location/Qualifiers
FT   CDS             208126..208815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48641"
FT                   /db_xref="GOA:D3F563"
FT                   /db_xref="UniProtKB/TrEMBL:D3F563"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48641.1"
FT                   /translation="MSTSQPPQGGQGQPGPQQPGGADQPAAPRRRTFGAGALAGVAAAV
FT                   LVIAGVGGYLIGHSSGDDEGTKSGKQAGYQKGLEAGRAEVTAEYQRGQPAYKQIFDEGK
FT                   AKGFREGMAQGTAQGERTGEAQGERTGFEQGQRVGVSTGESEGVRQGAAAVLGGFQTWT
FT                   DGAFYIVTVGASQTEGVPYTITSRSQVEPGTNYKLCGGGGSSQICQTAATAATPSEDAG
FT                   GAGAPSE"
     MSTSQPPQGG QGQPGPQQPG GADQPAAPRR RTFGAGALAG VAAAVLVIAG VGGYLIGHSS        60
     GDDEGTKSGK QAGYQKGLEA GRAEVTAEYQ RGQPAYKQIF DEGKAKGFRE GMAQGTAQGE       120
     RTGEAQGERT GFEQGQRVGV STGESEGVRQ GAAAVLGGFQ TWTDGAFYIV TVGASQTEGV       180
     PYTITSRSQV EPGTNYKLCG GGGSSQICQT AATAATPSED AGGAGAPSE                   229
//

If you have problems or comments...

PBIL Back to PBIL home page