(data stored in ACNUC7421 zone)

EMBL: CP001854.PE206

CP001854.PE206       Location/Qualifiers
FT   CDS             208836..209639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0206"
FT                   /product="alpha-acetolactate decarboxylase"
FT                   /EC_number="4.1.1.5"
FT                   /note="KEGG: mca:MCA1838 alpha-acetolactate decarboxylase;
FT                   TIGRFAM: alpha-acetolactate decarboxylase; PFAM:
FT                   alpha-acetolactate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48642"
FT                   /db_xref="GOA:D3F564"
FT                   /db_xref="InterPro:IPR005128"
FT                   /db_xref="UniProtKB/TrEMBL:D3F564"
FT                   /inference="protein motif:TFAM:TIGR01252"
FT                   /protein_id="ADB48642.1"
FT                   /translation="MAVDPRLVAALHLETVRHGALEDEHAAHVAFQTSTLAALLDGAYD
FT                   GDLTIGELRRHGDLGLGTFQALDGEMVVLDGEVWRARVDGSVEPVGDDERTPFAVVTPF
FT                   AADVTVAVEHELTHAQLLALVERRAPAGAATRAIRFDGRLVAVHARSVPRQRRPYPPLA
FT                   EAAAQQRDFMLEAADGALVGFAFPDVAAGVELPGVHLHAITADRRRGGHVLSARVGPGV
FT                   LRIGALRDLHVELPPGVELPDAPDPGGSADDARAALLDRIERDPG"
     MAVDPRLVAA LHLETVRHGA LEDEHAAHVA FQTSTLAALL DGAYDGDLTI GELRRHGDLG        60
     LGTFQALDGE MVVLDGEVWR ARVDGSVEPV GDDERTPFAV VTPFAADVTV AVEHELTHAQ       120
     LLALVERRAP AGAATRAIRF DGRLVAVHAR SVPRQRRPYP PLAEAAAQQR DFMLEAADGA       180
     LVGFAFPDVA AGVELPGVHL HAITADRRRG GHVLSARVGP GVLRIGALRD LHVELPPGVE       240
     LPDAPDPGGS ADDARAALLD RIERDPG                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page