(data stored in ACNUC7421 zone)

EMBL: CP001854.PE207

CP001854.PE207       Location/Qualifiers
FT   CDS             complement(209655..210962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0207"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: pin:Ping_0445 colicin uptake-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48643"
FT                   /db_xref="GOA:D3F565"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3F565"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADB48643.1"
FT                   /translation="MASDTLAAARARGATLHAAIAQATLAATLGALDDVEGARRHRSSA
FT                   TALLARVPGAPPAERMEALLWLGVADWAALGDVRAARDRFARAAVIARDDEDAAIAVPA
FT                   LAIRAHASAVAGDLGSAATTAAAAVDAARRADAPDLLALALAADAWQLGARGETAAAVA
FT                   VGDELLALPDHGPHELTVLAAWSAAPALLDAGDAARCAELLAPVTSVERLAPLAPRTRA
FT                   LLLELRVRVAVALDDGDDARRQLAALQAQAFVQTPLGIASSCCAAAEVALHDDRPANAE
FT                   ALANDAADAARDAPSRLLEIRATVLAGHAQAALAAPDVAAERFAEAEAAARAAGALPLA
FT                   QEAARHRRALTGGADAWPSAADYGLTVRQLEIARLVASGSTNREVAELLGISDHTVNTH
FT                   LRAIFRRFGVSRRRELGAALQEAATRDAATPPRATG"
     MASDTLAAAR ARGATLHAAI AQATLAATLG ALDDVEGARR HRSSATALLA RVPGAPPAER        60
     MEALLWLGVA DWAALGDVRA ARDRFARAAV IARDDEDAAI AVPALAIRAH ASAVAGDLGS       120
     AATTAAAAVD AARRADAPDL LALALAADAW QLGARGETAA AVAVGDELLA LPDHGPHELT       180
     VLAAWSAAPA LLDAGDAARC AELLAPVTSV ERLAPLAPRT RALLLELRVR VAVALDDGDD       240
     ARRQLAALQA QAFVQTPLGI ASSCCAAAEV ALHDDRPANA EALANDAADA ARDAPSRLLE       300
     IRATVLAGHA QAALAAPDVA AERFAEAEAA ARAAGALPLA QEAARHRRAL TGGADAWPSA       360
     ADYGLTVRQL EIARLVASGS TNREVAELLG ISDHTVNTHL RAIFRRFGVS RRRELGAALQ       420
     EAATRDAATP PRATG                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page