(data stored in ACNUC7421 zone)

EMBL: CP001854.PE208

CP001854.PE208       Location/Qualifiers
FT   CDS             complement(211180..211761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0208"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bja:bll2216
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48644"
FT                   /db_xref="GOA:D3F566"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3F566"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48644.1"
FT                   /translation="MAEDEPVRPRADARRNRDAVVAAAIRLLAEDPDASMREIADASGV
FT                   SRMTVYRHFPSREDLLRAVFAHVHDDFAALGSWIVGAQAPAEETLRRFAREIVARSEHY
FT                   RFLTGYRALADEIFNDEQVIADADDVLVWLRAAHARGELRAELPPDWQFRMLRGLVTAA
FT                   CEEVLTGRATAAESGGLLGETLVAALVAPR"
     MAEDEPVRPR ADARRNRDAV VAAAIRLLAE DPDASMREIA DASGVSRMTV YRHFPSREDL        60
     LRAVFAHVHD DFAALGSWIV GAQAPAEETL RRFAREIVAR SEHYRFLTGY RALADEIFND       120
     EQVIADADDV LVWLRAAHAR GELRAELPPD WQFRMLRGLV TAACEEVLTG RATAAESGGL       180
     LGETLVAALV APR                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page