(data stored in ACNUC7421 zone)

EMBL: CP001854.PE209

CP001854.PE209       Location/Qualifiers
FT   CDS             211844..213418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0209"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vap:Vapar_2891 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48645"
FT                   /db_xref="GOA:D3F567"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3F567"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADB48645.1"
FT                   /translation="MNTAAAAAARSRASGRDNPWLTLVAVALGVMMVGLDGTVVGVANP
FT                   TIAADLDASLAGLQWVTNGYLLALAVLLIVGGKLGDRFGRKKVFVIGIAGFALTSLLCA
FT                   LSTSTGMLVGARVLQGVAGALLMPNTLALLRAAFPPAELNRAVGIWGGASALAVASGPI
FT                   VGGLLVEHVSWESIFLLNLPLGLLAAVVTLRWVRESKDETHVGGFDVPGVALLSGGLFL
FT                   LIWGVIKAQDHGWGSAYVIGFGIAALVTLAGFVVREARTREPLLPLELFRNRSLSAGVV
FT                   LVVTGFFALFGILFFIGLYLQNVHGYSPIQTGVRLLPLTATFTISAPLGGLLTEKFGPR
FT                   VPLCLGMLILAGCFFGLTGLEVDTGYGGQWPFYLLIGLAMGFVIVASTEAIVGNAPVER
FT                   GGLAGGLQSTANQLGGVLGTAVLGSVIVSGVGSALAGNLADAGVPAAAAKAVEGQEELI
FT                   AQGVAPVTPGMPAGLAQAITDASFQSFMDGLHTAMWVSGVLALVSAAIALLVSRGHGAG
FT                   DGAAVHV"
     MNTAAAAAAR SRASGRDNPW LTLVAVALGV MMVGLDGTVV GVANPTIAAD LDASLAGLQW        60
     VTNGYLLALA VLLIVGGKLG DRFGRKKVFV IGIAGFALTS LLCALSTSTG MLVGARVLQG       120
     VAGALLMPNT LALLRAAFPP AELNRAVGIW GGASALAVAS GPIVGGLLVE HVSWESIFLL       180
     NLPLGLLAAV VTLRWVRESK DETHVGGFDV PGVALLSGGL FLLIWGVIKA QDHGWGSAYV       240
     IGFGIAALVT LAGFVVREAR TREPLLPLEL FRNRSLSAGV VLVVTGFFAL FGILFFIGLY       300
     LQNVHGYSPI QTGVRLLPLT ATFTISAPLG GLLTEKFGPR VPLCLGMLIL AGCFFGLTGL       360
     EVDTGYGGQW PFYLLIGLAM GFVIVASTEA IVGNAPVERG GLAGGLQSTA NQLGGVLGTA       420
     VLGSVIVSGV GSALAGNLAD AGVPAAAAKA VEGQEELIAQ GVAPVTPGMP AGLAQAITDA       480
     SFQSFMDGLH TAMWVSGVLA LVSAAIALLV SRGHGAGDGA AVHV                        524
//

If you have problems or comments...

PBIL Back to PBIL home page