(data stored in ACNUC7421 zone)

EMBL: CP001854.PE21

CP001854.PE21        Location/Qualifiers
FT   CDS             complement(24931..25836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0021"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="TIGRFAM: flagellar hook-associated protein 3; PFAM:
FT                   flagellin domain protein; KEGG: gur:Gura_4098 flagellar
FT                   hook-associated protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48457"
FT                   /db_xref="GOA:D3EYQ4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ4"
FT                   /inference="protein motif:TFAM:TIGR02550"
FT                   /protein_id="ADB48457.1"
FT                   /translation="MAMRITAQMTARTTVRDLQGDLAQLSQLQRKMSSGKEITKPSDDP
FT                   YGTGRALGLHGEVAGLQQYQKNVDDGTAWLNASDTALGKIGDAINRVRELLIRVGTDSA
FT                   GQAARDAAASEVDQLIETIKQEANIQYAGRYVFAGTATDRQPYQLLGPDTFNGNTDRIQ
FT                   REIGPGVELDVNTDISGLFGNGQAAGDNRLLDTLRDIADNMRAGRGDDLRGTDIARLDA
FT                   NVDVLNGIRADVGARTNRMEIADGRLSSLEENSIELLSKVEDADTVKTLIEYTTQQAAY
FT                   NMALRAGSNVVQNSLMDFLR"
     MAMRITAQMT ARTTVRDLQG DLAQLSQLQR KMSSGKEITK PSDDPYGTGR ALGLHGEVAG        60
     LQQYQKNVDD GTAWLNASDT ALGKIGDAIN RVRELLIRVG TDSAGQAARD AAASEVDQLI       120
     ETIKQEANIQ YAGRYVFAGT ATDRQPYQLL GPDTFNGNTD RIQREIGPGV ELDVNTDISG       180
     LFGNGQAAGD NRLLDTLRDI ADNMRAGRGD DLRGTDIARL DANVDVLNGI RADVGARTNR       240
     MEIADGRLSS LEENSIELLS KVEDADTVKT LIEYTTQQAA YNMALRAGSN VVQNSLMDFL       300
     R                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page