(data stored in ACNUC7421 zone)

EMBL: CP001854.PE210

CP001854.PE210       Location/Qualifiers
FT   CDS             complement(213415..214797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0210"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: mxa:MXAN_5903
FT                   TrkA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48646"
FT                   /db_xref="GOA:D3F568"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F568"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADB48646.1"
FT                   /translation="MAGSEHALKRDDPYLAPMPMPHLVLGEGILAQGVEKALLAAGVPV
FT                   RRLRRPTDRELRRALKDDVAAVTVIDRDDISALRSALLVEYVRPGIRLVVTIFDRTVAD
FT                   QLISSIPNCNVVSMADASVGAIVGPCVDPQLVALHRTDDGDLIGVRDSGDEPPAVAPLP
FT                   YHPPSAAVRLTRRLRAQFRPPDRAARLLVWSVAGLLALVLLETALALSTHHEPFVHAVY
FT                   EATKAITTVGPSGFFEHGATWIQLYGIASMALGLVLTAVFTAALVNRLLSRRLTGIFGT
FT                   RTIPRVDHVVVVGLGQVGFRLCLELRALGIDVVAVEQDEHAPNVALARGLKLPVVIGRG
FT                   GDRYMLEGLSLSRARALAAVTSDELANISISVAALAVQPGLRTILRAGSNEITQETAAL
FT                   FPIGIAQDLDRVAAAAVAATAIGHELAHAFVHRGATYIETPGGTERFPPAPPAVAAAPD
FT                   RP"
     MAGSEHALKR DDPYLAPMPM PHLVLGEGIL AQGVEKALLA AGVPVRRLRR PTDRELRRAL        60
     KDDVAAVTVI DRDDISALRS ALLVEYVRPG IRLVVTIFDR TVADQLISSI PNCNVVSMAD       120
     ASVGAIVGPC VDPQLVALHR TDDGDLIGVR DSGDEPPAVA PLPYHPPSAA VRLTRRLRAQ       180
     FRPPDRAARL LVWSVAGLLA LVLLETALAL STHHEPFVHA VYEATKAITT VGPSGFFEHG       240
     ATWIQLYGIA SMALGLVLTA VFTAALVNRL LSRRLTGIFG TRTIPRVDHV VVVGLGQVGF       300
     RLCLELRALG IDVVAVEQDE HAPNVALARG LKLPVVIGRG GDRYMLEGLS LSRARALAAV       360
     TSDELANISI SVAALAVQPG LRTILRAGSN EITQETAALF PIGIAQDLDR VAAAAVAATA       420
     IGHELAHAFV HRGATYIETP GGTERFPPAP PAVAAAPDRP                             460
//

If you have problems or comments...

PBIL Back to PBIL home page