(data stored in ACNUC7421 zone)

EMBL: CP001854.PE211

CP001854.PE211       Location/Qualifiers
FT   CDS             complement(214825..215250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_3076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48647"
FT                   /db_xref="GOA:D3F569"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3F569"
FT                   /inference="similar to AA sequence:KEGG:Gmet_3076"
FT                   /protein_id="ADB48647.1"
FT                   /translation="MTLYLDTSALVKLLVTEPGSEAVRAEAAAATELVSSHLTYVEIHS
FT                   ALARMHAGGRLTRRVHRRQLDAFVRMWEDVVVVPADAPVIDRAAALAERHVLRGFDALQ
FT                   LASAVELLGAGPARFASWDERLNAAAARERLELIPLG"
     MTLYLDTSAL VKLLVTEPGS EAVRAEAAAA TELVSSHLTY VEIHSALARM HAGGRLTRRV        60
     HRRQLDAFVR MWEDVVVVPA DAPVIDRAAA LAERHVLRGF DALQLASAVE LLGAGPARFA       120
     SWDERLNAAA ARERLELIPL G                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page