(data stored in ACNUC7421 zone)

EMBL: CP001854.PE212

CP001854.PE212       Location/Qualifiers
FT   CDS             complement(215247..215516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0212"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   gme:Gmet_3077 prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48648"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D3F570"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADB48648.1"
FT                   /translation="MREIGIRQLKNETSALIEQVEHGEVLTVTRRGRPVARVVPAGMSP
FT                   GIAQLVETGRVRWSGRKPALPPAVELRGDGPTAAEMVIDDRGDR"
     MREIGIRQLK NETSALIEQV EHGEVLTVTR RGRPVARVVP AGMSPGIAQL VETGRVRWSG        60
     RKPALPPAVE LRGDGPTAAE MVIDDRGDR                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page