(data stored in ACNUC7421 zone)

EMBL: CP001854.PE213

CP001854.PE213       Location/Qualifiers
FT   CDS             complement(215562..217172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48649"
FT                   /db_xref="UniProtKB/TrEMBL:D3F571"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48649.1"
FT                   /translation="MLLAALPACGGGADEPGGGQPRSGAATTAALPPATTPDRFAANFE
FT                   RVTGVRLVARPDGGGVRFDVPHVPDREPRLGIYAIRWSADSTARDGLLGAGPPDAQGRW
FT                   WKPDGAGAWTIAKPFGSHLVAEGPPSAARTPDARWLRLERAVAAAASGDLRTLPTAEQP
FT                   CRDRGLNALHGRTGACSVKGMPVTFVDALDELDTPLLQARVHGVETATVLEDPYGLLGS
FT                   RRADGRFVVVAFAVRNAGGGSIPSLHPQLHLGGRTFEQDPRAHALMPRSRSLPLEPGAT
FT                   FETWAAFDVPAALAAQASTGAFVLGTGADEHGLPSIDVEQGWIRLLAAPLSLPDPPDPA
FT                   QPPGGARSYRPPPTPFERGSGERIGATVRARYAASTFFPLPSTFAPGGIPIGSRAGICR
FT                   VPPLTTGVRAELRDAIRRQTPRGTLQPLDDDAILLADCGAAGRWALLTWTQVHRGRTVD
FT                   WIDELRDDGGGRWGGTARGVHPGCRMPLDAAAVWQIDVTACRRPPATPRAPAPSPAPRT
FT                   TPQPAPRDRERLPDGSSRA"
     MLLAALPACG GGADEPGGGQ PRSGAATTAA LPPATTPDRF AANFERVTGV RLVARPDGGG        60
     VRFDVPHVPD REPRLGIYAI RWSADSTARD GLLGAGPPDA QGRWWKPDGA GAWTIAKPFG       120
     SHLVAEGPPS AARTPDARWL RLERAVAAAA SGDLRTLPTA EQPCRDRGLN ALHGRTGACS       180
     VKGMPVTFVD ALDELDTPLL QARVHGVETA TVLEDPYGLL GSRRADGRFV VVAFAVRNAG       240
     GGSIPSLHPQ LHLGGRTFEQ DPRAHALMPR SRSLPLEPGA TFETWAAFDV PAALAAQAST       300
     GAFVLGTGAD EHGLPSIDVE QGWIRLLAAP LSLPDPPDPA QPPGGARSYR PPPTPFERGS       360
     GERIGATVRA RYAASTFFPL PSTFAPGGIP IGSRAGICRV PPLTTGVRAE LRDAIRRQTP       420
     RGTLQPLDDD AILLADCGAA GRWALLTWTQ VHRGRTVDWI DELRDDGGGR WGGTARGVHP       480
     GCRMPLDAAA VWQIDVTACR RPPATPRAPA PSPAPRTTPQ PAPRDRERLP DGSSRA           536
//

If you have problems or comments...

PBIL Back to PBIL home page