(data stored in ACNUC7421 zone)

EMBL: CP001854.PE214

CP001854.PE214       Location/Qualifiers
FT   CDS             217281..217625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48650"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:D3F572"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48650.1"
FT                   /translation="MSGEHDDGVAVSYKALRRGTRVRGSDGAEVGKVHRVQDNVRENIF
FT                   DGIVVETRAGKRFVDAPEVAHIAERAVTLTIPAADVAALPVPRSRLAQRMEQARVVRRA
FT                   RRAARDIRDR"
     MSGEHDDGVA VSYKALRRGT RVRGSDGAEV GKVHRVQDNV RENIFDGIVV ETRAGKRFVD        60
     APEVAHIAER AVTLTIPAAD VAALPVPRSR LAQRMEQARV VRRARRAARD IRDR             114
//

If you have problems or comments...

PBIL Back to PBIL home page