(data stored in ACNUC7421 zone)

EMBL: CP001854.PE215

CP001854.PE215       Location/Qualifiers
FT   CDS             217819..218193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48651"
FT                   /db_xref="InterPro:IPR024439"
FT                   /db_xref="UniProtKB/TrEMBL:D3F573"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48651.1"
FT                   /translation="MSRDQRHRARRREPSAFRCRNCGLDVPTDAPGTAHRNHCPSCLWS
FT                   RHLDDATPGDRAALCGSSMEPIAVAVRGDGEWVLVHRCAGCGELDLNRIAGDDNPLLLT
FT                   RLAVKPLAQPPFPLERLARL"
     MSRDQRHRAR RREPSAFRCR NCGLDVPTDA PGTAHRNHCP SCLWSRHLDD ATPGDRAALC        60
     GSSMEPIAVA VRGDGEWVLV HRCAGCGELD LNRIAGDDNP LLLTRLAVKP LAQPPFPLER       120
     LARL                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page