(data stored in ACNUC7421 zone)

EMBL: CP001854.PE216

CP001854.PE216       Location/Qualifiers
FT   CDS             218259..220772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0216"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48652"
FT                   /db_xref="UniProtKB/TrEMBL:D3F574"
FT                   /inference="protein motif:PFAM:PF01839"
FT                   /protein_id="ADB48652.1"
FT                   /translation="MPCAPAVPVRRRAGGLATVLVLAASLVPSGAAVAAPSPPTDEFAP
FT                   DPVQAEAVAGPAALALGDRNGDARPDAFIARWDGGVLVRPGTAAGPGTRPFDRSAEIVV
FT                   STPPGRLREIEAADWDGDGADDAVTLLDGEGLTVWTGNPLTGYLAIPDAHAVDTGDVDG
FT                   DGDLDALVTRIRRDEDLPLQVVSNGTPLPGIPVLERGAEIPACSEPTDARLVDVTDDGK
FT                   LDAVVVCPALGMVRVSPGLGGGSFGTAISSPAGASPFRLEAGDVVGDRNVDLAVTGSNV
FT                   VRIMRGFGDGSFGTPTSYAAAGRPRRVLLVDVDGDARLDLASATAETLDQDGVGYRLNR
FT                   GNGTFGTERRIAWAGAWDAQIADVTGDERPDLVAVANRAGSLAVWEGRAASDPVVELSG
FT                   LGVGVYEGAAGVALDPDARILGAAAANATTLTVTIASGRATGDVLSANPAAPFAPEWDP
FT                   ATAKLTISSALSQPADAWRAALRTVRFAHIASGLPGGATAGRRIVRAQLGTLPFASRSV
FT                   DVWLRPPEAGELRLTGVPVTGETLALDAGAWGGTPPVALRPTLERCPAGGGGCVALATD
FT                   LPYILRSADLGATLRVRGVGTGPDGTSATAYSPRTATIRRLAAPELLSGPGAVTADSTV
FT                   EVAFRGEEGATFACSVDAGAQAPCVSPLRVSGLADGSHTISVVQVMPSGARSAAAARVF
FT                   TVRRPVEPPPVTVTTTTPAPPPVTVTTPAPPPTTPVDPPRAAPRPALVVSSRATAAQLR
FT                   RGLLVRVQHVAKGARATATLQSGKRRVVATTLRATRAGTLQLRLRAASAAVAKLGRRNT
FT                   LGLAVTVAAPGARQVTLAARIAFRR"
     MPCAPAVPVR RRAGGLATVL VLAASLVPSG AAVAAPSPPT DEFAPDPVQA EAVAGPAALA        60
     LGDRNGDARP DAFIARWDGG VLVRPGTAAG PGTRPFDRSA EIVVSTPPGR LREIEAADWD       120
     GDGADDAVTL LDGEGLTVWT GNPLTGYLAI PDAHAVDTGD VDGDGDLDAL VTRIRRDEDL       180
     PLQVVSNGTP LPGIPVLERG AEIPACSEPT DARLVDVTDD GKLDAVVVCP ALGMVRVSPG       240
     LGGGSFGTAI SSPAGASPFR LEAGDVVGDR NVDLAVTGSN VVRIMRGFGD GSFGTPTSYA       300
     AAGRPRRVLL VDVDGDARLD LASATAETLD QDGVGYRLNR GNGTFGTERR IAWAGAWDAQ       360
     IADVTGDERP DLVAVANRAG SLAVWEGRAA SDPVVELSGL GVGVYEGAAG VALDPDARIL       420
     GAAAANATTL TVTIASGRAT GDVLSANPAA PFAPEWDPAT AKLTISSALS QPADAWRAAL       480
     RTVRFAHIAS GLPGGATAGR RIVRAQLGTL PFASRSVDVW LRPPEAGELR LTGVPVTGET       540
     LALDAGAWGG TPPVALRPTL ERCPAGGGGC VALATDLPYI LRSADLGATL RVRGVGTGPD       600
     GTSATAYSPR TATIRRLAAP ELLSGPGAVT ADSTVEVAFR GEEGATFACS VDAGAQAPCV       660
     SPLRVSGLAD GSHTISVVQV MPSGARSAAA ARVFTVRRPV EPPPVTVTTT TPAPPPVTVT       720
     TPAPPPTTPV DPPRAAPRPA LVVSSRATAA QLRRGLLVRV QHVAKGARAT ATLQSGKRRV       780
     VATTLRATRA GTLQLRLRAA SAAVAKLGRR NTLGLAVTVA APGARQVTLA ARIAFRR          837
//

If you have problems or comments...

PBIL Back to PBIL home page