(data stored in ACNUC7421 zone)

EMBL: CP001854.PE217

CP001854.PE217       Location/Qualifiers
FT   CDS             complement(220781..221569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0217"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   Polyketide cyclase/dehydrase; KEGG: scl:sce2341
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48653"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D3F575"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADB48653.1"
FT                   /translation="MSDDDRREIRIEVEVDATPEEAWEAIATGPGITAWYVPATVDERV
FT                   GGEIALDFGGEMRESTRIVVWDPPHRLAYDIPSERGRGLAFEFVIEAQAGGTSLVRLVN
FT                   SGFGTSADWDAEYDGMDSGWRLFLANLVLYLRHFPGQHAASLIVNGVAAGPRPAAWERL
FT                   VQAAGLPAAPAVGDRVETGGDSTPALAGVVERIADEMLTLRTDTPAPGHVFFAAEGGGI
FT                   QIFTSFYAYFFGDDADAVVASETPGWQAWMAAHFPPPADD"
     MSDDDRREIR IEVEVDATPE EAWEAIATGP GITAWYVPAT VDERVGGEIA LDFGGEMRES        60
     TRIVVWDPPH RLAYDIPSER GRGLAFEFVI EAQAGGTSLV RLVNSGFGTS ADWDAEYDGM       120
     DSGWRLFLAN LVLYLRHFPG QHAASLIVNG VAAGPRPAAW ERLVQAAGLP AAPAVGDRVE       180
     TGGDSTPALA GVVERIADEM LTLRTDTPAP GHVFFAAEGG GIQIFTSFYA YFFGDDADAV       240
     VASETPGWQA WMAAHFPPPA DD                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page