(data stored in ACNUC7421 zone)

EMBL: CP001854.PE218

CP001854.PE218       Location/Qualifiers
FT   CDS             complement(221657..222025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48654"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D3F576"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48654.1"
FT                   /translation="MLRLMDDLGAPTSYLALATGVPVHDADGKRIGTVEHVLADDAEDV
FT                   FDGIVVDTRSGPGGLRFADADQVERLYERGVVLKVGEDELHDPEPGAAVIDVDPADLDE
FT                   SPLTARLRRAWDWISGRY"
     MLRLMDDLGA PTSYLALATG VPVHDADGKR IGTVEHVLAD DAEDVFDGIV VDTRSGPGGL        60
     RFADADQVER LYERGVVLKV GEDELHDPEP GAAVIDVDPA DLDESPLTAR LRRAWDWISG       120
     RY                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page