(data stored in ACNUC7421 zone)

EMBL: CP001854.PE219

CP001854.PE219       Location/Qualifiers
FT   CDS             complement(222057..223211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0219"
FT                   /product="peptidase dimerization domain protein"
FT                   /note="PFAM: peptidase dimerisation domain protein;
FT                   peptidase M20; KEGG: rso:RS03691 glutamate
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48655"
FT                   /db_xref="GOA:D3F577"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D3F577"
FT                   /inference="protein motif:PFAM:PF07687"
FT                   /protein_id="ADB48655.1"
FT                   /translation="MPPVDAWVQQAAAGIAERAERDLEALVAVSSPSGDVHGAEDCVAV
FT                   VRALVPPAAAIERIPCSSPGHADDVVVRIAGSGSGRLLLLGHLDTVVPHERHEPLRRDG
FT                   ERLVGSGTVDMKGGDVLALGLLRALAEQPQRFAEVALLLVVDEEWRTGPMVHVDRFAGW
FT                   DGCLCFEAGELAPDGSDAVIVRRKAAGTLRVRARGVAAHAGSAPHKGRNALLALAAAAQ
FT                   AVAAAHAPDGHDRLTSVPTMLHSGDAFNVVPDAGELACDLRSDRTAAFEEVRALVPREL
FT                   AGVELDAELTRVWPAMDARAATAPLLASAAELLGRPLVAAGRGGASDASHVAPAIPFTV
FT                   DGLGPRGGRAHAPGEFVLAAALHSRAEVAVALAAAVLDAAGATV"
     MPPVDAWVQQ AAAGIAERAE RDLEALVAVS SPSGDVHGAE DCVAVVRALV PPAAAIERIP        60
     CSSPGHADDV VVRIAGSGSG RLLLLGHLDT VVPHERHEPL RRDGERLVGS GTVDMKGGDV       120
     LALGLLRALA EQPQRFAEVA LLLVVDEEWR TGPMVHVDRF AGWDGCLCFE AGELAPDGSD       180
     AVIVRRKAAG TLRVRARGVA AHAGSAPHKG RNALLALAAA AQAVAAAHAP DGHDRLTSVP       240
     TMLHSGDAFN VVPDAGELAC DLRSDRTAAF EEVRALVPRE LAGVELDAEL TRVWPAMDAR       300
     AATAPLLASA AELLGRPLVA AGRGGASDAS HVAPAIPFTV DGLGPRGGRA HAPGEFVLAA       360
     ALHSRAEVAV ALAAAVLDAA GATV                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page