(data stored in ACNUC7421 zone)

EMBL: CP001854.PE22

CP001854.PE22        Location/Qualifiers
FT   CDS             complement(25839..27170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0022"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein; KEGG: ppd:Ppro_3455
FT                   flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48458"
FT                   /db_xref="GOA:D3EYR3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYR3"
FT                   /inference="protein motif:TFAM:TIGR02492"
FT                   /protein_id="ADB48458.1"
FT                   /translation="MPISSFMGLQTSLRGLIAHQQALNTTGHNVANANTPGFSRQEAIF
FT                   GAMSALRLPTNSGTTGLGAQLGTGVDVLGIRRIRDSFLDLQFRGTNMQLGDASARTQSL
FT                   EQVELSFGEPSSSGINALLGRFWDAWSALASAPEEGSAARTAVIEMANTLAGAFQTVHA
FT                   QLTRVAAQAQGKYDEITGPAGDVDIWAQELAQLNRTIAHAVTVGQVPNDLMDRRDLLID
FT                   RLSELSQVSVTDVGDGSVRVEFGGVTLVDPAAAGGYTWPQTLTSRDGKLGALRDLASPT
FT                   GPALSFRDRLDTVAADLVARVNALHRAPGGVDFFAPAGTTADRISVVATAATVVAGSTA
FT                   DRGRNDVANAIAQLRNGSINRTYSALVSEVGSVVRRASSAEAIQQSLVDNIDDRRQSVQ
FT                   GVSPDEEMTNMIRFQRGYQASARTMSTLDEMLDTLINRTGRVGL"
     MPISSFMGLQ TSLRGLIAHQ QALNTTGHNV ANANTPGFSR QEAIFGAMSA LRLPTNSGTT        60
     GLGAQLGTGV DVLGIRRIRD SFLDLQFRGT NMQLGDASAR TQSLEQVELS FGEPSSSGIN       120
     ALLGRFWDAW SALASAPEEG SAARTAVIEM ANTLAGAFQT VHAQLTRVAA QAQGKYDEIT       180
     GPAGDVDIWA QELAQLNRTI AHAVTVGQVP NDLMDRRDLL IDRLSELSQV SVTDVGDGSV       240
     RVEFGGVTLV DPAAAGGYTW PQTLTSRDGK LGALRDLASP TGPALSFRDR LDTVAADLVA       300
     RVNALHRAPG GVDFFAPAGT TADRISVVAT AATVVAGSTA DRGRNDVANA IAQLRNGSIN       360
     RTYSALVSEV GSVVRRASSA EAIQQSLVDN IDDRRQSVQG VSPDEEMTNM IRFQRGYQAS       420
     ARTMSTLDEM LDTLINRTGR VGL                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page